1 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
2 <html xmlns="http://www.w3.org/1999/xhtml">
4 <!-- $Id: help.html 1500 2011-03-01 19:32:53Z ftruscot $ -->
6 <title>Nucleus Admin Help</title>
7 <style type="text/css">
10 font-family: verdana, arial;
16 border-bottom: 1px gray dashed;
23 border: 1px solid #ddd;
24 background-color: whitesmoke;
35 background-color: #ddd;
41 background-color: #ddd;
60 text-decoration: underline;
64 background-color: whitesmoke;
68 border: 3px solid red;
78 border: 1px solid #ccc;
82 background-color: #eee;
90 background-color: #eee;
99 <h1>Nucleus Popup Help</h1>
100 <p>Please hold on while the page is being downloaded (about 100KB).</p>
105 <a name="future"></a>
106 <a name="allowpastposting"></a>
107 <h1>Add Later/Earlier</h1>
109 <p>The 'Add Later' option on add-item forms allows you to mark an item to become visible only at the exact time you've specified. Before that time has come, the item will not be viewable anywhere in the public part of your site.</p>
110 <p>This date <strong>must</strong> be in the future, unless the 'Allow posting to the past' option is enabled for the blog to which you want to add the item.</p>
111 <h2>Allow posting to the past</h2>
112 <p>When enabled, you'll be allowed to specify the date on which an item should be added, and to edit the timestamp of already existing items.</p>
115 <div class="page"><a name="changedate"></a>
116 <h1>Change post date/time</h1>
118 The 'Update Timestamp' option allows you to change the posting date and/or time of an item. If you changed the content of an item, this is a way bring the story back to the top of your front page.</p>
119 <p>But, the unique id connected to the item will not change, so your visitors can still find out that the item was originally posted later than items with a lower id.</p>
123 <div class="page"><a name="autosave"></a>
125 <p>The Autosave function saves an item as a <a href="#draft">draft</a> after 10 minutes editing. It should avoid that unsaved changes get lost. It is usefull for users that work for a long time on an item and often forget to save their work.</p>
126 <p>If you want to invoke Autosave before the 10 minutes are past, you can press the '<strong>Auto save now</strong>' button at the end of the form.</p>
127 <p>The Autosave function can be enabled and disabled in the member options.</p>
131 <div class="page"><a name="draft"></a>
134 Draft items are not yet viewable in the public blog. They might come in handy when you are working on a story, and something comes in between. Your draft items will be listed on the main page, so you can continue your work when you have the time to do so.</p>
135 <p>When editing drafts, choose the '<strong>Add now</strong>' radiobutton and hit the 'Edit item' button to make them visible.
139 <div class="page"><a name="extended"></a>
140 <h1>Extended part</h1>
142 Items have an optional extended part that you can use for continued stories. e.g. when a story is too long to put on the main page of your blog, you can write an introduction in the body part and the rest in the extended part. When viewing your main blog page, you will then see 'read more' links (as defined by the templates).
145 If you want to write an introduction only for <em>some</em> of your items, you could use the <a href="#templatevar-smartbody">smartbody</a> template variable to make a selection out of the body text and the extended text.
149 <div class="page"><a name="shortblogname"></a>
150 <h1>Short Blog Name</h1>
152 The short blog name is used mainly in the admin area to indicate which items are associated with which blog.
155 It can also be used in alternative index files, to make a second weblog available:
159 include('./config.php');
160 selectBlog('myshortblogname');
166 <div class="page"><a name="blogdefaultskin"></a>
167 <h1>Default Skin</h1>
169 The default skin selected in the blog settings is the skin that should be used when the blog is displayed, and there is no other skin selected (through arguments in the URL)
174 <div class="page"><a name="blognotify"></a>
175 <h1>Notify Address</h1>
177 This option contains one or multiple e-mail addresses to which notification e-mails should be sent when new comments are added. Leave empty if you don't want notification. The given e-mail addresses must, of course, be valid.
180 If you're using multiple addresses, you should use a semicolon (<strong>;</strong>) as a separator.
183 <b>Note:</b> As the maximum length of the settings fields is 128 characters, there's only a limited amount of e-mail addresses you can list.
186 <b>Note:</b> When you set up your own e-mail address as notification address, you won't get notified of the items/comments that you wrote yourself. Assuming that you know what you wrote, that shouldn't be a problem.
190 <div class="page"><a name="blogmaxcomments"></a>
191 <h1>Max Amount of Comments</h1>
193 This is the maximum number of comments that will be shown on the <em>main page</em>. <strong>This is NOT a restriction on the total number of comments that can be made</strong>. On the detail pages, all comments will be shown, even if there are more than the maximum amount chosen.
195 <p class="note"><strong>Note:</strong>
196 Inside templates, this variable can be overridden by an optional parameter of the <a href="#templatevar-comments">comments</a> templatevar.
200 <div class="page"><a name="blogtimeoffset"></a>
203 If the time on your server is not equal to the time where you live, you might want to add an offset to the server time in order to get the correct time. Use negative values to subtract (negation sign). The current server time is listed as a reference.
206 <p>If your local time is 20:35 and the server time is listed as 14:35, you'll need to set the time offset equal to 6 in order to get your blog time to 20:35
208 <p class="note"><strong>Note:</strong> Fractional offsets can be used as well, for people living in half time zones. e.g. an offset of <strong>1.5</strong> equals an offset of 1 hour and 30 minutes.</p>
211 <div class="page"><a name="blogupdatefile"></a>
214 Nucleus can edit a file for you whenever a new item is added to the blog. The contents of that file will be a timestamp of the last change. The use of such a file could be useful for services which check a file on your server once in a while to see if there were updates, and generate 'updated weblogs' from that. Pointing them to your main blog could cause false update warnings to be sent out when visitors add comments or when you change something to the skins or templates.
217 When you don't need an update file, just leave the field empty.
220 Please note that the location of the update file is relative to the admin-area, so you might want to use an absolute path (something like <tt>/path/to/your/website/update.txt</tt>). Also make sure the update file already exists and is writable (<a href="tips.html#filepermissions" onclick="window.open(this.href);return false;" class="out" title="quick guide on changing file permissions">chmod it to 666</a> if you want to be sure).
224 <div class="page"><a name="teamadmin"></a>
227 Blog administrators have the following extra rights:
231 <li>They can manage the team</li>
232 <li>They can edit blog settings</li>
233 <li>They can edit/delete all items by all authors (from the blog of which they are admin)</li>
234 <li>They can delete the blog</li>
238 A blog can have multiple admins, but there must be at least one admin at all times.
243 <div class="page"><a name="superadmin"></a>
244 <h1>Administrator Privileges</h1>
247 A so called <em>super-admin</em> has <strong>full access</strong> to all functions and all weblogs, even if she is not on the blog team.
251 On top of that: a super-admin has the right to create new weblogs, to change general settings, to change templates, to change skins and to manage the members (creation/ manipulation/ deletion of members).
255 Usually, there will be only one super-admin, the site administrator.
260 <div class="page"><a name="canlogin"></a>
263 As a <a href="#superadmin" title="Administrator Privileges">superadmin</a>, you can disallow individual members to login to the admin area.
267 <div class="page"><a name="defaultblog"></a>
268 <h1>Default Blog</h1>
270 This is the blog that will be used when no other blog has been specified in the request.
274 <div class="page"><a name="baseskin"></a>
277 <p>The option tells Nucleus which skin to fall back to when no such decision can be automatically made. This happens when skin parts are empty, when no blog or skin is implicitly/explicitly selected.</p>
278 <p>Most users don't need to worry about this setting.</p>
281 <div class="page"><a name="cookies"></a>
284 <h2>Cookie Lifetime</h2>
286 When a member logs in, a cookie is stored in his browser, so she doesn't need to log in again when she comes back the next day. The lifetime of this cookie decided when it will become invalid:</p>
288 <li><strong>Session cookies</strong> get deleted when you exit the browser</li>
289 <li>Cookies with a lifetime of <strong>one month</strong> will stay on the computer until you don't use/visit the site for a month. Using this option, you'll never have to login again (unless you've logged out yourself, or logged in from another computer)</li>
292 <h2>Cookie Path & Cookie Domain</h2>
294 These settings are advanced settings. Normally, you shouldn't change them at all. In that case, cookie path is a simple slash ('/') and cookie domain is empty.
297 <h2>Secure Cookies</h2>
299 Normally, this should be set to 'no'. You should only set it to 'yes' when you have a HTTPS url and want cookies only to be sent over such a https connection.
302 <h2>'Last Visit' Cookie</h2>
304 You can setup Nucleus to store a cookie in which the time of the visitors last visit is stored. This can be used to put indications next to <a href="#templatenew">new items</a>
310 <div class="page"><a name="locale"></a>
313 You can choose a locale to be used when nucleus creates content for you. The content generated by Nucleus includes the admin-area, the error messages, forms in skins, ...
317 There are two places where a translation can be chosen: the global site settings include a locale option.
318 Next to that, logged in members can override this setting if they want to.
322 When both of these settings are invalid, 'en_Latn_US' is used as the default locale.
325 <p class="note"><strong>Note:</strong> Extra translation files can be downloaded from the <a href="http://www.nucleuscms.org/" onclick="window.open(this.href);return false;" class="out" title="Nucleus CMS Website">Nucleus Website</a>. (opens a new window)</p>
329 <div class="page"><a name="allowaccountcreation"></a>
330 <h1>Account Creation</h1>
332 You can either allow or disallow your visitors to create their own 'member' account. They won't be allowed to add items to a blog (unless the admin adds them to a team), but they can login to the administration area and change their settings, and even delete or modify the comments they made.
336 <div class="page"><a name="allownewmemberlogin"></a>
337 <h1>New Member: can login ?</h1>
339 When you allow <a href="#allowaccountcreation">creation of member accounts</a> by your visitors, this setting defines whether or not accounts created in that way will have the ability to <a href="#canlogin">login to the administration area</a>.
344 <div class="page"><a name="messageservice"></a>
345 <h1>Message Service</h1>
348 For the privacy of your members, you can hide all e-mail addresses and allow members to send an e-mail message to each other through the script. The message that will be sent out will however contain the e-mail addresses of both users, so they can then do continued communication through regular e-mail. This service can be disabled.
353 By default, non members cannot use the message service (because there's no way to check the validity of the e-mail address they enter). You can relax this restriction by allowing non-members to use the message service too. When submitting a message, they will be asked to enter their e-mail address, which will show up in the <tt>From:</tt> headers of the e-mail you receive.
358 <div class="page"><a name="disablesite"></a>
359 <h1>Disable Site</h1>
361 It's possible to disable your entire Nucleus site. You might want to do this when you are doing some configuration, or when something went horribly wrong :-)
364 The URL that needs to be configured is an URL to which the visitor will be redirected.
367 Exceptions: the <strong>admin-area</strong> is still available, and <strong><a href="#superadmin">super-admins</a></strong> can still see the entire site. (don't forget to re-enable your site afterwards ;-))
372 <div class="page"><a name="urlmode"></a>
374 <p>Using this option, you can switch between URL styles:</p>
376 <li><strong>Normal</strong>: URLs looking like <code>http://host/index.php?itemid=1234</code></li>
377 <li><strong>Fancy</strong>: URLs looking like <code>http://host/item/1234</code></li>
379 <p class="note"><strong>Note:</strong> In order to get the 'Fancy URL' mode working, some extra actions are required. They're described in the <a href="tips.html" class="out" onclick="window.open(this.href);return false;">Tips & Suggestions</a> (opens in new window)</p>
383 <div class="page"><a name="defaultlistsize"></a>
384 <h1>Default List Size</h1>
385 <p>(3.40) Using this option, you can set the default size of lists in the Admin Area. Value should be an integer. 10 is a good default for most users.</p>
388 <div class="page"><a name="debugvars"></a>
390 <p>(3.40) Using this option, you can set whether unresolved Vars (SkinVars, TemplateVars, ItemVars) are shown on the blog. Default is <code>No</code>.</p>
393 <div class="page"><a name="templateitems"></a>
394 <h1>Templates: Items</h1>
396 When items are shown, the following setup is repeated for each item:
405 <p>These three blocks all refer to a template-part, which define what the result looks like.</p>
409 <p>Within these template, a series of so called <a href="#templatevars-overview" title="Find out which variables are available">template variables can be used</a> to insert item data.</p>
412 <p><a href="#templateitemsexample">An example</a></p>
416 <div class="page"><a name="templateitemsexample"></a>
417 <h1>Templates: Items</h1>
419 An example for the <b>item body</b> template:
422 <pre><h1><%title%></h1>
424 <p><%body%></p>
426 <div class="metadata">
427 <a href="<%itemlink%>">link</a> -
428 <%date%> <%time%> -
429 <a href="<%authorlink%>"><%author%></a> -
433 <p>The result would become something like this:</p>
435 <div class="example">
436 <h4 style="margin: 2px;">This is an item</h4>
437 <p style="margin: 2px; padding: 0px;">This is the text for the item</p>
438 <div style="font-style: italic; margin: 2px;">
439 <a href="#templateitemsexample">link</a> -
440 August 8th 2002 18:51 -
441 <a href="#templateitemsexample">karma</a> -
442 <a href="#templateitemsexample">no comments</a>
449 <div class="page"><a name="templatecomments"></a>
450 <h1>Templates: comments</h1>
452 <p>There are three possible structures for a comments block.</p>
456 When comments are displayed (like on detail pages, or on the main page when there are less than the maximum allowed amount of comments)
458 comments body (repeated)
459 comments footer</pre>
462 When there are no comments at all
468 When there are comments, but there are more than the maximum allowed number. (only applies when not on a detailed item page)
475 <p>Inside these template-parts, some <a href="#templatevars-comments" title="Overview of comments-related template variables">comments-related variables</a> are available</p>
480 <a name="templatecommentheaders"></a>
481 <a name="templatecommentfooters"></a>
482 <h1>Templates: Comment headers/footers</h1>
486 <p>While the comments-body is repeated for each comment, the header and footer are only displayed once. A typicall structure would look like this:</p>
491 comments footer</pre>
492 <p>In these template-parts, <a href="#templatevars-comments" title="Overview of comments-related template variables">comments-related templatevars</a> are available</p>
497 <pre><ul></pre>
499 <pre><li><%user%>: <%body%></li></pre>
501 <pre></ul></pre>
505 <li>karma: nice!</li>
506 <li>xiffy: yes indeed!</li>
511 <div class="page"><a name="templatemorelink"></a>
512 <h1>Templates: Link to extended entry</h1>
514 This is the template that will be used to format the <a href="#templatevar-morelink">morelink templatevar</a> that is available in the item templates. <a href="#templatevars-overview">Available variables</a> are the same as in the item templates.
517 When there's no extended part of the item, the <code><%morelink%></code> templatevar will have no effect.
521 <pre><code><a href="<%itemlink%>">[Read More!]</a></code></pre>
525 <div class="page"><a name="templatearchivelists"></a>
527 <h1>Templates: Archive Lists</h1>
529 <p>The archive lists are formatted as listed below:</p>
531 <pre>archivelist header
532 archivelist listitem (repeated for each archive)
533 archivelist footer</pre>
536 Available variables: (in the header and footer, only <tt>blogid</tt> is allowed)
544 <td>ID of the weblog</td>
547 <td>link to the archive, which you can embed in a <code><a href=".."></code> tag.</td>
550 <td>Number of the month (2 digits: 01-12)</td>
553 <td>Year (4 digits)</td>
556 <td>Day of month (2 digits; only when in day mode)</td>
559 <p>A more flexible way to add the date of the archive to the listitem, is to use <a href="#strftime">strftime</a> variables. If you find this too complicated, use the following:</p>
561 <pre><code><a href="<%archivelink%>">%B, %Y</a><br /></code></pre>
564 <p>To change the locale to your local settings, change the <a href="#templatelocale">locale</a>.</p>
571 <div class="page"><a name="templatecategorylists"></a>
572 <h1>Templates: Category Lists</h1>
574 <p>The category lists are formatted as listed below:</p>
576 <pre>categorylist header
577 categorylist listitem (repeated)
578 categorylist footer</pre>
580 <p>Available variables: (in the header and footer, only <tt>blogid</tt>, <tt>blogurl</tt>, <tt>self</tt>, <tt>catiscurrent</tt>, and <tt>currentcat</tt> are allowed)</p>
587 <td>ID of the weblog</td>
590 <td>URL of the blog (as defined in blogsettings)</td>
593 <td>Current page, without parameters (e.g. <tt>index.php</tt>)</td>
596 <td>a link to the most recent items for a category, which you can embed in a <a href=".."> tag.</td>
602 <td>Category name</td>
605 <td>Category description</td>
607 <td>catiscurrent</td>
608 <td>yes if category is currently selected, no if it is not. Useful to style current category.</td>
611 <td>Synonym of catiscurrent</td>
614 <p><a href="#categorylistexample">View an example</a></p>
618 <div class="page"><a name="categorylistexample"></a>
619 <h1>Templates: Category Lists Example</h1>
621 <a href="#templatecategorylists">(go back)</a>
625 <pre><code><ul>
626 <li><a href="<blogurl%>">All</a></li></code></pre>
629 <pre><code><li><a href="<%catlink%>"><%catname%></a></li></code></pre>
632 <pre><code></ul></code></pre>
637 <li><a href="#categorylistexample">All</a></li>
638 <li><a href="#categorylistexample">myCategory</a></li>
639 <li><a href="#categorylistexample">yourCategory</a></li>
644 <div class="page"><a name="templatebloglists"></a>
645 <h1>Templates: Blog Lists</h1>
647 <p>The blog lists are formatted as listed below:</p>
650 bloglist listitem (repeated)
651 bloglist footer</pre>
653 <p>Available variables in list item field: </p>
660 <td>URL of the blog (as generated by Link::create_blogid_link() function)</td>
663 <td>URL of the blog (as defined in blogsettings)</td>
666 <td>Description of the blog</td>
669 <td>Name of the blog (either full or short, depending on skinvar parameter).</td>
672 <p>Available variables in header and footer fields: </p>
679 <td>URL of the site (as defined in global settings)</td>
682 <td>Name of the site (as defined in global settings).</td>
685 <p><a href="#bloglistexample">View an example</a></p>
689 <div class="page"><a name="bloglistexample"></a>
690 <h1>Templates: Blog Lists Example</h1>
692 <a href="#templatebloglists">(go back)</a>
696 <pre><code><ul>
697 <li><a href="<siteurl%>"><sitename%></a></li></code></pre>
700 <pre><code><li><a href="<%bloglink%>"><%blogname%></a></li></code></pre>
703 <pre><code></ul></code></pre>
708 <li><a href="#bloglistexample">My Site</a></li>
709 <li><a href="#bloglistexample">mainblog</a></li>
710 <li><a href="#bloglistexample">newsblog</a></li>
721 <div class="page"><a name="templatelocale"></a>
722 <h1>Templates: Locale</h1>
724 This is actually not a template-part, it's a setting. Setting it allows the date and time preferences when to be localized. Names of months and days will be in the desired locale, etc.
728 The possible values depend according to which machine Nucleus is running on. Some possible values are
732 <li><strong>en</strong>: English</li>
733 <li><strong>dutch</strong>: Dutch</li>
738 More info in the <a href="http://www.opengroup.org/onlinepubs/7908799/xsh/strftime.html" onclick="window.open(this.href);return false;" class="out" title="Open Group specification">Open Group Specification</a> for strftime. (opens a new window)
742 The locale is used for the <a href="#templatedatetime">date and time format</a>, for the <a href="#templatedateheads">dateheaders</a>, and for the <a href="#templatearchivelists">archivelist items</a>
747 <div class="page"><a name="templatedatetime"></a>
748 <h1>Templates: Date and Time formats</h1>
750 These are used to format dates and times into the <code><%date%></code> and <code><%time%></code> vars (see <a href="#templatevars-overview">template vars</a>). The formatting is done according to the <a href="#templatelocale">locale</a>
754 <a href="#strftime">More info on the available vars</a>. If want to get started quickly, use "%x" to format the date and "%X" to format the time.
759 <div class="page"><a name="templatedateheads"></a>
760 <h1>Template: Date headers/footers</h1>
763 The date header and date footer can contain date and time vars. <a href="#strftime">More info on the available vars</a>. If you want to get started quickly, use "%x" to format the date. The locale which is used to format the date, is determined by the <a href="#templatelocale">locale-setting</a> in the template.</p>
766 In the date header, the template variable <%%daylink%%> is allowed to insert a link to the archive for that day. <strong>Note the double '%'! It's necessary to avoid %d to be expanded as the current day of the month.</strong> Also, if you just want to add a '%' character somewhere, you should also put it twice ('%%') or it will be gone on your website.
770 Sample for date header:
774 <div class="day">
775 <h1>%d %B</h1>
779 Sample for date footer:
786 <p>And another example for the date head using daylink</p>
789 <div class="day">
790 <h1>%d %B</h1>
791 <a href="<%%daylink%%>">(archive)</a>
796 <div class="page"><a name="templatehighlight"></a>
797 <h1>Templates: Highlight</h1>
799 The highlighting is used when performing searches. This is actually used in a regular expression, so you might want to escape some characters by putting a backslash before them. The place where the highlighted word will come, is indicated by "\0".
804 <pre><code><span style='background-color:yellow'>\0</span></code></pre>
808 <div class="page"><a name="templatenothingfound"></a>
809 <h1>Templates: nothing found</h1>
812 Shown when a search has been performed and no results were found.
815 <p>Available variables:</p>
822 <td>ID of the weblog</td>
825 <td>the query that was used in the search</td>
830 <pre><code>No search results found for <b><%query%></b></code></pre>
834 <div class="page"><a name="templatecommentbody"></a>
835 <h1>Templates: Comment body</h1>
837 This is the part of the template used to display a single comment. In this template-part, <a href="#templatevars-comments" title="Overview of comments-related template variables">comments-related templatevars</a> are available.</p>
840 <pre><code><h2>Comment by <%userlink%>:</h2>
842 <p><%body%></p>
844 <div class="metadata">
845 (from <%host%> on <%date%> at <%time%>)
846 </div></code></pre>
850 <div class="example">
851 <h4 style="margin: 2px;">Comment by <a href="#templatecommentbody">karma</a>:</h4>
852 <p style="margin: 2px;">Nice!</p>
853 <div style="margin:2px;font-size:smaller;">(from host.example.org on 2003-03-02 at 13:30)</div>
858 <div class="page"><a name="templatepopups"></a>
859 <h1>Templates: Media & Popups</h1>
861 These templates are used to format links to popup image windows and media objects (non-pictures). The available variables for each of the templates are described below
864 <h2>Popup Link Code</h2>
871 <td>an <a href... link ready to use</td>
873 <td>rawpopuplink</td>
874 <td>only the url inside href="..."</td>
877 <td>javascript code to open window</td>
880 <td>the alternate text (link text)</td>
889 <td>(=same as text)</td>
892 <td>direct link to the image (URL)</td>
895 <td>a non-popup A-tag to the image, ready to use.</td>
899 <h2>Inline Image Code</h2>
906 <td>an IMG-tag, ready to use</td>
909 <td>direct link to the image (URL)</td>
912 <td>the alternate text (link text)</td>
921 <td>an A-tag to the image, ready to use.</td>
924 <h2>Media Object Link Code</h2>
931 <td>an A-tag, ready to use</td>
934 <td>direct link to the file (URL)</td>
937 <td>the alternate text (link text)</td>
942 <div class="page"><a name="templatememberextra"></a>
943 <h1>Templates: Member Extra</h1>
945 This is a template you can use to add an extra indication that a comment-author is a member. It ends up in the <code><%authtext%></code> variable for use in the <a href="#templatecommentbody">comment body</a>
948 <p>Inside this template-part, some <a href="#templatevars-comments" title="Overview of comments-related template variables">comments-related variables</a> are available.</p>
952 <div class="page"><a name="templatecommentcontinued"></a>
953 <h1>Templates: Comments Read More</h1>
955 This is the format of the link that will be added at the end of <code><%short%></code>, which is a variable for use in the <a href="#templatecommentbody">comment body</a>
958 <p>Inside this template-part, some <a href="#templatevars-comments" title="Overview of comments-related template variables">comments-related variables</a> are available (except for the <code><%short%></code> variable).</p>
963 <a href="<%itemlink%>">[more]</a>
968 <div class="page"><a name="templatecommentwords"></a>
969 <h1>Templates: commentword</h1>
971 Most likely, you'll rather want to write "1 comment" than "1 comment(s)". The "One comment" and "Many comments" template parts can be used for this purpose. They will be used to fill the <code><%commentword%></code> variable that you can use elsewhere.
975 If there is only 1 comment, <code><%commentword%></code> will be equal to the contents of the "one comment" part. If there are many comments (more than one), <code><%commentword%></code> will be equal to the contents of the "two (or more) comments" part.
979 Typical values are "comment" and "comments". <strong>No special variables can be used here</strong>.
985 <div class="page"><a name="templateeditlink"></a>
986 <h1>Templates: Edit Link</h1>
988 This template defines how the <a href="#templatevar-edit">edit-templatevar</a> will be marked up. You can use any of the <a href="#templatevars-overview">template variables</a> here.
993 <pre><code><a href="<%editlink%>"
994 onclick="<%editpopupcode%>">edit</a></code></pre>
1001 <div class="page"><a name="skinpartindex"></a>
1002 <h1>Skins: Main Index</h1>
1004 This skinpart is used to show the most recent entries of your weblog. It's usually the home page of your site.
1008 Very basic buildup for a main index:
1014 <title>My Weblog</title>
1018 <h1>My Weblog</h1>
1019 <%blog(mytemplate,20)%>
1026 This will show the 20 most recent items of the default weblog (unless overridden), using the 'mytemplate' template.
1031 <div class="page"><a name="skinpartitem"></a>
1032 <h1>Skins: Detail Pages</h1>
1034 These pages are used to show the full items, all comments that were made and a form to add comments.
1038 Very basic buildup for a detailed item page:
1044 <title>My Weblog :: Item</title>
1048 <h1>Item</h1>
1049 <%item(detailed)%>
1051 <h1>Comments</h1>
1052 <%comments(detailed)%>
1054 <h1>Add Comment</h1>
1055 <%commentform%>
1062 This will show the item and comments using the 'detailed' template, and add a standard commentform.
1068 <div class="page"><a name="skinpartarchivelist"></a>
1069 <h1>Skins: Archive List</h1>
1071 An overview of all the months for which archives are available, and links to those archives
1075 Very basic buildup for an archive list:
1081 <title>My Weblog :: Archives</title>
1085 <h1>Archives</h1>
1086 <%archivelist(default)%>
1093 This will show the list of all available archive files, using the 'default' template
1098 <div class="page"><a name="skinpartarchive"></a>
1099 <h1>Skins: Archive</h1>
1101 An archive for one month. Behaves like a main index, but shows all the items from a certain month.
1105 Very basic buildup for an archive page:
1111 <title>My Weblog :: Archive</title>
1115 <h1>Archive</h1>
1116 <%archive(default)%>
1123 This will show the requested archive using the 'default' template
1130 <div class="page"><a name="skinpartsearch"></a>
1131 <h1>Skins: Search</h1>
1133 Used to show search results.
1137 Very basic buildup for a searchresults page:
1143 <title>My Weblog :: Search</title>
1147 <h1>Search</h1>
1148 <%searchform%>
1150 <h1>Searchresults</h1>
1151 <%searchresults(default)%>
1158 This will show search results using the 'default' template.
1163 <div class="page"><a name="skinparterror"></a>
1164 <h1>Skins: Errors</h1>
1166 Used when there is an error
1172 <title>My Weblog :: Error</title>
1176 <h1>Error!</h1>
1177 <%errormessage%>
1179 <br /><br />
1181 <a href="javascript:history.back();">Back</a>
1188 This will show the error message, plus a link to go back.
1193 <div class="page"><a name="skinpartmember"></a>
1194 <h1>Skins: Member</h1>
1196 Used to show member details.
1200 Very basic buildup for a member-detail page:
1206 <title>My Weblog :: Member details</title>
1210 <h1>Info about <%member(name)%></h1>
1212 <a href="<%member(url)%>"><%member(url)%></a>
1214 <h1>Send Message</h1>
1215 <%membermailform%>
1222 This will show the members name, website address and a mailform.
1228 <div class="page"><a name="skinpartimagepopup"></a>
1229 <h1>Skins: Image Popup</h1>
1231 Used when a media file (image) needs to be shown in a popup window. This skin defines the layout that will be used in that case.
1235 Very basic buildup for an imagepopup page:
1241 <title><%imagetext%></title>
1242 <style type="text/css">
1243 img { border: none; }
1247 <a href="javascript:window.close();"><%image%></a>
1255 <div class="page"><a name="skinpartspecial"></a>
1256 <h1>Skins: Main Index</h1>
1258 This skinpart is used to show special, non-blog, content on your site. It can be used to show static content, or to wrap other
1259 dynamic applications, like forms, inside the skin of your blog. It is accessed by the name of the special skin part, in this way
1260 (assuming the special skin part is named <code>fred</code>):
1262 <code>http://www.yoursite.tld/index.php?special=fred</code>
1264 <p>Further discussion of the use of this feature can be found on the support forum:
1265 <a href="http://forum.nucleuscms.org/viewtopic.php?t=16501" title="Special Skin Parts">Nucleus 3.31 and Static Pages</a>
1269 Very basic buildup for a special skin part:
1275 <title>My Weblog</title>
1279 <h1>About My Site</h1>
1280 <p>This page was published in order
1281 to provide a platform to publicize the plight
1282 of the peeping-polly parrot whose present
1283 prognosis is perturbingly pessimistic.</p>
1290 This will show the text of the body as indicated above. Also, many SkinVars work on special pages, so you can make
1291 the page look just like the other pages and use SkinVars to show an index of the whole site, or a list of members, etc...
1298 <div class="page"><a name="shortnames"></a>
1299 <h1>Shortnames & Display Names</h1>
1301 Weblogs, templates and skin should all have a short name next to the full name or description.
1305 A short name consists of <strong>only</strong> the characters a-z and 0-9, and <strong>cannot</strong> contain spaces
1309 Display names are used for members. They can contain a-z, A-Z, 0-9 and spaces, but the spaces cannot be placed at the beginning or end of the name.
1318 <div class="page"><a name="templatenew"></a>
1319 <h1>Template: 'New' indication</h1>
1321 When the <a href="#cookies">'last visit' cookie</a> option is activated, the contents of the 'Indication of new item'-template is copied into the <%new%> variable for items that have been added since the last visit. The <code><%new%></code> variable can e.g. be used in the <a href="#templateitems">item body</a>-template.
1325 When the 'last visit' cookie is disabled, or the item is not 'new', this template part will not be used.
1330 <div class="page"><a name="strftime"></a>
1331 <h1>Time variables overview</h1>
1333 <p>The following conversion specifiers are recognized in the format string <small>(taken from the PHP documentation for the strftime function)</small>. More info in the <a href="http://www.opengroup.org/onlinepubs/7908799/xsh/strftime.html" onclick="window.open(this.href);return false;" class="out" title="Open Group specification">Open Group Specification</a></p>
1336 <li><strong>%a</strong> - abbreviated weekday name according to the current locale</li>
1337 <li><strong>%A</strong> - full weekday name according to the current locale</li>
1338 <li><strong>%b</strong> - abbreviated month name according to the current locale</li>
1339 <li><strong>%B</strong> - full month name according to the current locale</li>
1340 <li><strong>%c</strong> - preferred date and time representation for the current locale</li>
1341 <li><strong>%d</strong> - day of the month as a decimal number (range 00 to 31)</li>
1342 <li><strong>%H</strong> - hour as a decimal number using a 24-hour clock (range 00 to 23)</li>
1343 <li><strong>%I</strong> - hour as a decimal number using a 12-hour clock (range 01 to 12)</li>
1344 <li><strong>%j</strong> - day of the year as a decimal number (range 001 to 366)</li>
1345 <li><strong>%m</strong> - month as a decimal number (range 1 to 12)</li>
1346 <li><strong>%M</strong> - minute as a decimal number</li>
1347 <li><strong>%p</strong> - either `am' or `pm' according to the given time value, or the corresponding strings for the current locale</li>
1348 <li><strong>%S</strong> - second as a decimal number</li>
1349 <li><strong>%U</strong> - week number of the current year as a decimal number, starting with the first Sunday as the first day of the first week</li>
1350 <li><strong>%W</strong> - week number of the current year as a decimal number, starting with the first Monday as the first day of the first week</li>
1351 <li><strong>%w</strong> - day of the week as a decimal, Sunday being 0</li>
1352 <li><strong>%x</strong> - preferred date representation for the current locale without the time</li>
1353 <li><strong>%X</strong> - preferred time representation for the current locale without the date</li>
1354 <li><strong>%y</strong> - year as a decimal number without a century (range 00 to 99)</li>
1355 <li><strong>%Y</strong> - year as a decimal number including the century</li>
1356 <li><strong>%Z</strong> - time zone or name or abbreviation</li>
1357 <li><strong>%%</strong> - a literal `%' character</li>
1362 <div class="page"><a name="sendping"></a>
1363 <h1>Ping weblog listing services</h1>
1365 When updating your weblog, you can choose to send an update notification (ping) to various weblog listing services. They provides a list of recently updated weblogs to everyone who requests it. Lots of websites are using this data, so you might receive some extra hits when enabling the ping.
1367 <p class="note"><strong>Note:</strong> For this feature to work correctly, you need to fill out both the weblog URL and the weblog name in the blogsettings.
1372 <div class="page"><a name="blogsearchable"></a>
1374 <h1>Always include in search</h1>
1376 <p>When the 'include in search' option is selected, the weblog will <strong>always</strong> be included in searches, even if the search is done on another weblog.</p>
1378 <p>As an example, suppose you have two blogs called 'lifelog' and 'linkdump', with the 'include in search' enabled for 'linkdump'. Now, a search query on 'lifelog' will also search through 'linkdump', while a search query on 'linkdump' will only search entries in 'linkdump'</p>
1384 <div class="page"><a name="convertbreaks"></a>
1385 <h1>Convert Linebreaks</h1>
1387 By default, Nucleus converts linebreaks in your items to <code><br /></code> tags, so a linebreak will also show up in your (X)HTML output
1390 Advanced users, or users striving for the semantic web (<tt>br</tt> tags don't add any information, they're just used for markup), might find this feature annoying, and turn this feature off.
1395 <div class="page"><a name="media"></a>
1398 Nucleus allows you to upload media files (images, video, sound, ...) to your website
1401 Some settings are needed to do this:
1404 <li><strong>Media dir</strong>: location on the server where the media files will be saved (local filesystem)</li>
1405 <li><strong>Media URL</strong>: location of the media files</li>
1406 <li><strong>Allow upload</strong>: It's possible to disable file upload</li>
1407 <li><strong>Allowed filetypes for upload</strong>: a bunch of extensions uploaded files can have (seperated by commas, case insensitive)</li>
1408 <li><strong>Max. upload file size</strong>: Puts a limit on the size of uploaded files</li>
1409 <li><strong>Prefix Media Files</strong>: When this option is turned on, uploaded file will be prefixed with the current date. Uploading a file named 'bunny.jpg' on April 8, 2003 will then result in a file named 20030408-bunny.jpg. The reason why you might want to do this, is when you're uploading tons of files, and don't want problems with duplicate names.</li>
1413 Each member has his own private collection of media files. Next to that, subdirectories that are under the media dir are seen as global collections (shared between members).
1416 <p>Uploading is only possible when a member is on the team of at least one of the blogs, to prevent abuse.</p>
1420 <div class="page"><a name="protectmemnames"></a>
1421 <h1>Protect Member Names</h1>
1422 <p>When this option is enabled, non-logged in members cannot add comments using the same name as registered members. The reason to do this would be to avoid guest impersonating members.</p>
1426 <div class="page"><a name="pluginurl"></a>
1428 <p>This setting is the base URL for plugin admin areas. Usually it will look like the following</p>
1429 <pre>http://hostname.com/nucleus/plugins/</pre>
1432 <div class="page"><a name="skinsurl"></a>
1434 <p>This setting is the base URL for the Nucleus skins directory. Usually it will look like the following</p>
1435 <pre>http://hostname.com/skins/</pre>
1438 <div class="page"><a name="actionurl"></a>
1440 <p>This setting is the absolute URL of the <code>action.php</code> script that comes with Nucleus. Usually it will look like the following</p>
1441 <pre>http://hostname.com/actions.php</pre>
1446 <div class="page"><a name="additem"></a>
1447 <h1>Adding items</h1>
1448 <p>When adding items to a weblog, there are four kinds of template variables that you can use in the body text, title or extended part:</p>
1450 <li><a href="#templatevar-popup"><%popup(...)%></a> to insert a popup image</li>
1451 <li><a href="#templatevar-popup"><%image(...)%></a> to insert an inline image</li>
1452 <li><a href="#templatevar-popup"><%media(...)%></a> to insert a media object</li>
1454 <p>Usually, these tags are inserted by the 'insert media' button in the JavaScript toolbar</p>
1463 <a name="skinvar-referer"></a>
1464 <h1>Skinvar: referer</h1>
1465 <p>Inserts the refering URL (can be empty)</p>
1472 <a href="<%referer%>">back</a>
1478 <a name="skinvar-itemid"></a>
1479 <h1>Skinvar: itemid</h1>
1480 <p>Inserts the ID of the currently selected item</p>
1493 <a name="skinvar-itemlink"></a>
1495 <h1>Skinvar: itemlink</h1>
1497 <p>Adds a permanent link for the item.</p>
1504 <li><strong><em>linktext</em></strong>: when present, a full <code><a href...</code> tag will be outputted, rather than a raw link</li>
1519 <a name="skinvar-itemtitle"></a>
1520 <h1>Skinvar: itemtitle</h1>
1521 <p>Inserts the title of the item, with HTML-stripped off and entities encoded</p>
1534 <a name="skinvar-archivedate"></a>
1535 <h1>Skinvar: archivedate</h1>
1536 <p>Inserts a formatted date for an archive date. Using no parameters, this will either insert '15 august 2002' or 'august 2002' if the archive is for august 2002</p>
1545 <td><a href="#templatelocale">Locale</a> in which the date must be formatted</td>
1548 <td>Date format (<a href="#strftime">strftime variables</a>)</td>
1556 Archive for <%archivedate%>
1557 Archive for <%archivedate(dutch)%>
1558 Archive for <%archivedate(en,%B %Y)%>
1565 <a name="skinvar-blog"></a>
1566 <h1>Skinvar: blog</h1>
1569 Inserts the most recently added items of the currently active blog (usually the default one) into the skin.
1576 <li><strong>template</strong>: name of the template to use</li>
1580 <li><strong><em>amount</em></strong>: the amount of items to show (default = 10). Can also contain an offset telling Nucleus to start only from the given item. e.g. <code>10(5)</code> shows 10 items starting from item 5</li>
1581 <li><strong><em>category</em></strong>: name of the category to show</li>
1588 index, item, archive, archivelist, search
1594 <%blog(default,15)%>
1595 <%blog(default,5(15))%>
1596 <%blog(mytemplate)%>
1597 <%blog(mytemplate,5,mycategory)%>
1603 <a name="skinvar-bloglist"></a>
1604 <h1>Skinvar: bloglist</h1>
1607 Shows a list of all blogs that are defined in your Nucles CMS.
1614 <li><strong>template</strong>: name of the template to use</li>
1618 <li><strong>bnametype</strong>: whether the Blog Name (<code>name</code>) or the Short Blog Name (<code>shortname</code>) of the Blog is used. Default setting is the Blog name (<code>name</code>).</li>
1621 <li><strong>orderby</strong>: (3.40) Attribute of the blog used for determinig the order in which the blogs are listed. Supported values are <code>number</code>, <code>name</code>, <code>shortname</code>, <code>description</code>. Default is <code>number</code>.</li>
1624 <li><strong>direction</strong>: (3.40) Direction of the sorting, <code>asc</code> for ascending order, or <code>desc</code> for descending order. Default is <code>asc</code>.
1637 <%bloglist(default/index)%>
1638 <%bloglist(default/index,name)%>
1639 <%bloglist(default/index,shortname)%>
1640 <%bloglist(default/index,name,name,asc)%>
1648 <a name="skinvar-otherblog"></a>
1649 <h1>Skinvar: otherblog</h1>
1652 Inserts the most recently added items of a given blog into the skin.
1659 <li><strong>blogname</strong>: name of the blog to show</li>
1660 <li><strong>template</strong>: name of the template to use</li>
1664 <li><strong><em>amount</em></strong>: the amount of items to show (default = 10). Can also contain an offset telling Nucleus to start only from the given item. e.g. <code>10(5)</code> shows 10 items starting from item 5</li>
1665 <li><strong><em>category</em></strong>: name of the category to show</li>
1678 <%otherblog(myblog,default,15)%>
1679 <%otherblog(yourblog,mytemplate)%>
1680 <%otherblog(yourblog,mytemplate,15,mycategory)%>
1681 <%otherblog(yourblog,mytemplate,5(15),mycategory)%>
1695 <a name="skinvar-item"></a>
1696 <h1>Skinvar: item</h1>
1699 Shows the currently selected item (without comments) using a given template
1704 <li><strong>template</strong>: name of the template to use</li>
1716 <%item(mytemplate)%>
1730 <a name="skinvar-comments"></a>
1731 <h1>Skinvar: comments</h1>
1734 Shows the comments for the currently selected item using a given template.
1739 <li><strong>template</strong>: name of the template to use</li>
1751 <%comments(mytemplate)%>
1763 <a name="skinvar-archive"></a>
1764 <h1>Skinvar: archive</h1>
1767 Shows the archive for the selected month and the selected blog (usually the default one), using a given template
1774 <li><strong>template</strong>: name of the template to use</li>
1778 <li><strong><em>category</em></strong>: name of the category to show</li>
1791 <%archive(mytemplate)%>
1792 <%archive(mytemplate,mycategory)%>
1801 <a name="skinvar-otherarchive"></a>
1802 <h1>Skinvar: otherarchive</h1>
1805 Shows the archive for the selected month, using the given blog and template
1812 <li><strong>blogname</strong>: name of the blog to use</li>
1813 <li><strong>template</strong>: name of the template to use</li>
1817 <li><strong><em>category</em></strong>: name of the category to show</li>
1830 <%otherarchive(myblog,mytemplate)%>
1831 <%otherarchive(myblog,mytemplate,mycategory)%>
1843 <a name="skinvar-archivelist"></a>
1844 <h1>Skinvar: archivelist</h1>
1847 Shows the list of available archives for the currently selected blog (usually the default one), using a given template
1854 <li><strong>template</strong>: name of the template to use</li>
1858 <li><strong><em>category</em></strong>: name of the category to show</li>
1859 <li><strong><em>limit</em></strong>: limits the amount of links shown (e.g. if you only want to show links to the past 3 months)</li>
1866 index, archive, archivelist, search, item
1871 <a name="skinvar-archivedaylist"></a>
1872 <h1>Skinvar: archivedaylist</h1>
1875 The same as the <a href="#skinvar-archivelist">archivelist</a> skinvar, but shows an entry for each <em>day</em> instead of for each <em>month</em>
1882 <li><strong>template</strong>: name of the template to use</li>
1886 <li><strong><em>category</em></strong> name of the category to show</li>
1887 <li><strong><em>limit</em></strong>: limits the amount of links shown (e.g. if you only want to show links to the past 3 months)</li>
1894 index, archive, archivelist, search, item
1901 <%archivedaylist(mytemplate)%>
1902 <%archivedaylist(mytemplate,mycategory)%>
1909 <a name="skinvar-otherarchivedaylist"></a>
1910 <h1>Skinvar: otherarchivedaylist</h1>
1913 The same as the <a href="#skinvar-otherarchivelist">otherarchivelist</a> skinvar, but shows an entry for each <em>day</em> instead of for each <em>month</em>
1921 <li><strong>blogname</strong>: name of the blog</li>
1922 <li><strong>template</strong>: name of the template to use</li>
1926 <li><strong><em>category</em></strong>: name of the category to show</li>
1939 <%otherarchivedaylist(yourblog,mytemplate)%>
1940 <%otherarchivedaylist(yourblog,mytemplate,mycategory)%>
1946 <a name="skinvar-archiveyearlist"></a>
1947 <h1>Skinvar: archiveyearlist</h1>
1950 The same as the <a href="#skinvar-archivelist">archivelist</a> skinvar, but shows an entry for each <em>year</em> instead of for each <em>month</em>
1957 <li><strong>template</strong>: name of the template to use</li>
1961 <li><strong><em>category</em></strong> name of the category to show</li>
1962 <li><strong><em>limit</em></strong>: limits the amount of links shown (e.g. if you only want to show links to the past 3 years)</li>
1969 index, archive, archivelist, search, item
1976 <%archiveyearlist(mytemplate)%>
1977 <%archiveyearlist(mytemplate,mycategory)%>
1984 <a name="skinvar-otherarchiveyearlist"></a>
1985 <h1>Skinvar: otherarchiveyearlist</h1>
1988 The same as the <a href="#skinvar-otherarchivelist">otherarchivelist</a> skinvar, but shows an entry for each <em>year</em> instead of for each <em>month</em>
1996 <li><strong>blogname</strong>: name of the blog</li>
1997 <li><strong>template</strong>: name of the template to use</li>
2001 <li><strong><em>category</em></strong>: name of the category to show</li>
2014 <%otherarchiveyearlist(yourblog,mytemplate)%>
2015 <%otherarchiveyearlist(yourblog,mytemplate,mycategory)%>
2023 <a name="skinvar-otherarchivelist"></a>
2024 <h1>Skinvar: otherarchivelist</h1>
2027 Shows the list of available archives for a given blog, using a given template
2034 <li><strong>blogname</strong>: name of the blog</li>
2035 <li><strong>template</strong>: name of the template to use</li>
2039 <li><strong><em>category</em></strong>: name of the category to show</li>
2052 <%otherarchivelist(yourblog,mytemplate)%>
2053 <%otherarchivelist(yourblog,mytemplate,mycategory)%>
2061 <a name="skinvar-categorylist"></a>
2062 <h1>Skinvar: categorylist</h1>
2065 Inserts a list of categories for a blog (defaults to the currently selected blog), using a given template
2072 <li><strong>template</strong>: name of the template to use</li>
2076 <li><strong><em>blogname</em></strong>: short name of the blog to use</li>
2083 index, archive, archivelist, search, item, [error, member, special if blogname parameter specified]
2089 <%categorylist(mytemplate)%>
2090 <%categorylist(mytemplate,myweblog)%>
2098 <a name="skinvar-category"></a>
2099 <h1>Skinvar: category</h1>
2102 Inserts some information about the currently selected category. When no category is selected, does nothing.
2109 <li><strong><em>type</em></strong>: What information to include. Can be <b>name</b> (default), <b>desc</b> or <b>id</b></li>
2123 <%category(id)%>
2124 <%category(desc)%>
2125 <%category(name)%>
2132 <a name="skinvar-ifcat"></a>
2133 <h1>Skinvar: ifcat</h1>
2135 <p class="deprecated">Deprecated as of Nucleus v2.0. Use <a href="#skinvar-if"><%if(category)%></a> instead.</p>
2141 <li><em>text</em>: Text to show</li>
2154 <%ifcat(Current Category: )%><%category%>
2163 <a name="skinvar-searchresults"></a>
2164 <h1>Skinvar: searchresults</h1>
2167 Shows the searchresult for the current query
2174 <li><strong>template</strong>: name of the template to use</li>
2178 <li><strong><em>maxresults</em></strong>: maximum amount of results to show</li>
2191 <%searchresults(mytemplate)%>
2200 <a name="skinvar-othersearchresults"></a>
2201 <h1>Skinvar: othersearchresults</h1>
2204 Shows the searchresult in a give blog for the current query, using the given template
2211 <li><strong>blogname</strong>: name of the blog to use</li>
2212 <li><strong>template</strong>: name of the template to use</li>
2216 <li><strong><em>maxresults</em></strong>: maximum amount of results to show</li>
2229 <%othersearchresults(myblog,mytemplate)%>
2241 <a name="skinvar-query"></a>
2242 <h1>Skinvar: query</h1>
2245 Inserts the current search query.
2275 <a name="skinvar-version"></a>
2276 <h1>Skinvar: version</h1>
2278 <p>Inserts the current Nucleus version.</p>
2302 <a name="skinvar-charset"></a>
2303 <h1>Skinvar: charset</h1>
2305 <p>Inserts the character set encoding used by the current translation file.</p>
2329 <a id="skinvar-locale" name="skinvar-locale"></a>
2330 <h1>Skinvar: locale</h1>
2331 <p>The present locale based on a site's establishing it is output.</p>
2346 <a name="skinvar-previtem"></a>
2347 <h1>Skinvar: previtem</h1>
2350 Inserts the ID of the previous item in the blog
2376 <a name="skinvar-nextitem"></a>
2377 <h1>Skinvar: nextitem</h1>
2380 Inserts the ID of the next item in the blog
2402 <a name="skinvar-nextitemtitle"></a>
2403 <h1>Skinvar: nextitemtitle</h1>
2406 Inserts the title of the next item in the blog
2421 <%nextitemtitle%>
2428 <a name="skinvar-previtemtitle"></a>
2429 <h1>Skinvar: previtemtitle</h1>
2432 Inserts the title of the previous item in the blog
2447 <%previtemtitle%>
2456 <a name="skinvar-prevarchive"></a>
2457 <h1>Skinvar: prevarchive</h1>
2460 Inserts the <code>archive</code> attribute that corresponds to the archive of either 1 day or 1 month back. This value can be used inside URLs to select an archive.
2464 <li>If the shown archive is for one specific day, the value has the form <code>YYYY-MM-DD</code></li>
2465 <li>If the shown archive is for a full month, the value has the form <code>YYYY-MM</code></li>
2479 <pre><code><a href="index.php?archive=<%prevarchive%>>....</code></pre>
2489 <a name="skinvar-nextarchive"></a>
2490 <h1>Skinvar: nextarchive</h1>
2493 Inserts the <code>archive</code> attribute that corresponds to the archive of either 1 day or 1 month further in time. This value can be used inside URLs to select an archive.
2497 <li>If the shown archive is for one specific day, the value has the form <code>YYYY-MM-DD</code></li>
2498 <li>If the shown archive is for a full month, the value has the form <code>YYYY-MM</code></li>
2512 <pre><code><a href="index.php?archive=<%nextarchive%>>....</code></pre>
2518 <a name="skinvar-archivetype"></a>
2519 <h1>Skinvar: archivetype</h1>
2522 Either <tt>day</tt> or <tt>month</tt>, indicating which type of archive is currently being shown
2541 <a name="skinvar-todaylink"></a>
2542 <h1>Skinvar: todaylink</h1>
2545 Inserts a link to the main page of the weblog. Takes into account the currently selected blog and category.
2552 <li><strong><em>linktext</em></strong>: when present, a full <code><a href...</code> tag will be outputted, rather than a raw link</li>
2578 <a name="skinvar-archivelink"></a>
2579 <h1>Skinvar: archivelink</h1>
2582 Inserts a link to the archive for the currently selected blog and category (or the default blog when no blog selected)
2590 <li><strong><em>linktext</em></strong>: when present, a full <code><a href...</code> tag will be outputted, rather than a raw link</li>
2604 <%archivelink%>
2615 <a name="skinvar-nextlink"></a>
2616 <h1>Skinvar: nextlink</h1>
2619 Inserts a link to the next item (on item pages) or to the next archive (on archive pages)
2626 <li><strong><em>linktext</em></strong>: when present, a full <code><a href...</code> tag will be outputted, rather than a raw link</li>
2627 <li><strong><em>amount</em></strong>: for search and index skins: the amount of items to go forward/backward</li>
2628 <li><strong><em>recount</em></strong>: for search and index skins: set to yes to force extra query to recount items on page.
2629 This is useful for more complex pages where the blog skinvar may be called multiple times because of the use of the offset.
2630 Try setting this if nextlink seems to be not advancing the expected number of items.</li>
2638 item, archive, search, index
2645 <%nextlink(Next Page,10)%>
2646 <%nextlink(,10)%>
2647 <%nextlink(,10,yes)%>
2660 <a name="skinvar-prevlink"></a>
2661 <h1>Skinvar: prevlink</h1>
2664 Inserts a link to the previous item (on item pages) or to the previous archive (on archive pages). For search and index pages
2671 <li><strong><em>linktext</em></strong>: when present, a full <code><a href...</code> tag will be outputted, rather than a raw link</li>
2672 <li><strong><em>amount</em></strong>: for search and index skins: the amount of items to go forward/backward</li>
2679 item, archive, search, index
2698 <a name="skinvar-errormessage"></a>
2699 <h1>Skinvar: errormessage</h1>
2702 Inserts the message corresponding to the error that occurred
2717 <%errormessage%>
2730 <a name="skinvar-imagetext"></a>
2731 <h1>Skinvar: imagetext</h1>
2733 <p class="deprecated">This skinvar is deprecated since Nucleus v2.0. You should use <a href="#skinvar-image"><code><%image(caption)%></code></a> instead</p>
2736 Inserts the caption text for a popup image
2759 <a name="skinvar-image"></a>
2760 <h1>Skinvar: image</h1>
2763 Inserts the selected image (for popup images)
2773 <td><strong>imgtag</strong> (default)</td>
2774 <td>Full XHTML <code><img ... /></code> tag</td>
2776 <td><strong>url</strong></td>
2777 <td>Image file URL</td>
2779 <td><strong>width</strong></td>
2780 <td>image width</td>
2782 <td><strong>height</strong></td>
2783 <td>image height</td>
2785 <td><strong>caption</strong></td>
2786 <td>image caption (text to go with image)</td>
2807 <a name="skinvar-vars"></a>
2808 <h1>Skinvar: vars</h1>
2810 <p class="deprecated">This skinvar is deprecated since Nucleus v2.0. It's a small pain to insert this HTML yourself using the <a href="#skinvar-itemid">itemid skinvar</a></p>
2813 Inserts a hidden form-input field with the itemid.
2816 <code><input type="hidden" name="itemid" value="<strong>1234</strong>" /></code>
2836 <a name="skinvar-sitevar"></a>
2837 <h1>Skinvar: sitevar</h1>
2840 Includes a site variable
2845 <li><strong>type</strong>: name of the variable to show:
2847 <li><em>url</em>: URL of the site</li>
2848 <li><em>name</em>: Name of the site</li>
2849 <li><em>admin</em>: E-mail address of the administrator</li>
2863 <%sitevar(name)%>
2864 <%sitevar(url)%>
2865 <a href="mailto:<%sitevar(email)%>">Admin</a>
2876 <a name="skinvar-blogsetting"></a>
2877 <h1>Skinvar: blogsetting</h1>
2880 Inserts a setting specific to the currently selected blog (usually the default one)
2885 <li><strong>type</strong>: which setting to add
2887 <li><em>id</em>: ID of the blog</li>
2888 <li><em>url</em>: URL of the blog</li>
2889 <li><em>name</em>: Name of the blog (long name)</li>
2890 <li><em>desc</em>: Description of the blog</li>
2891 <li><em>short</em>: Short name of the blog</li>
2899 index, archive, archivelist, search, item, member
2905 <%blogsetting(name)%>
2906 <%blogsetting(id)%>
2907 <%blogsetting(desc)%>
2908 <a href="<%blogsetting(url)%>">...</a>
2919 <a name="skinvar-member"></a>
2920 <h1>Skinvar: member</h1>
2923 Inserts some info about on the currently logged in member. On member detail pages, extra options are available to show the same information for the requested member.
2926 <p>When the visitor is not logged in, the <em>your...</em> parameters will insert nothing</p>
2930 <li><strong>type</strong>: which information to show.
2931 <p>Information on the logged in member:</p>
2933 <li><em>yourname</em>: nickname of the member (the one used to login)</li>
2934 <li><em>yourrealname</em>: full name of the member</li>
2935 <li><em>yournotes</em>: extra information a member can set for him/herself</li>
2936 <li><em>yoururl</em>: URL of the members website</li>
2937 <li><em>youremail</em>: email address </li>
2938 <li><em>yourid</em>: ID</li>
2939 <li><em>yourprofileurl</em>: URL of the members profile (member details) page</li>
2941 <p>Information on the requested member (only available on member detail pages):</p>
2943 <li><em>name</em>: nickname of the member (the one used to login)</li>
2944 <li><em>realname</em>: full name of the member</li>
2945 <li><em>notes</em>: extra information a member can set for him/herself</li>
2946 <li><em>url</em>: URL of the members website</li>
2947 <li><em>email</em>: email address of the member</li>
2948 <li><em>id</em>: ID</li>
2962 <%if(loggedin)%>
2963 you are <%member(yourrealname)%>
2975 <a name="skinvar-preview"></a>
2976 <h1>Skinvar: preview</h1>
2979 Inserts an item-preview into the page, using a given template (to be used in conjunction with <a href="#skinvar-additemform">additemform</a>)
2984 <li><strong>template</strong>: name of the template to be used</li>
2996 <%preview(mytemplate)%>
3004 <a name="skinvar-adminurl"></a>
3005 <h1>Skinvar: adminurl</h1>
3007 <p>Inserts the full URL to the Admin Area</p>
3021 <a href="<%adminurl%>">Admin Area</a>
3030 <a name="skinvar-additemform"></a>
3031 <h1>Skinvar: additemform</h1>
3034 Shows an add-item form for the currently selected blog (usually the default one). Mostly used in conjunction with <a href="#skinvar-preview">preview</a>
3049 <%additemform%>
3060 <a name="skinvar-include"></a>
3061 <h1>Skin/Templatevar: include</h1>
3064 Includes a textfile into the output. The contents of the file is not parsed in any way, so you cannot use skin/templatevars or use PHP code (see <a href="#skinvar-parsedinclude">parsedinclude</a> and <a href="#skinvar-phpinclude">phpinclude</a> if you want parsed includes)
3069 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute). Note that an URL can also be used here.</li>
3074 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
3086 <%include(filename.txt)%>
3087 <%include(/home/user/myself/filename.txt)%>
3088 <%include(http://mydomain.com/filename.html)%>
3100 <a name="skinvar-phpinclude"></a>
3101 <h1>Skin/Templatevar: phpinclude</h1>
3104 Includes a php-file into the output. The contents of the file is parsed by the PHP parser, so be careful. Nucleus skin/templatevars are <b>not</b> parsed! (see <a href="#skinvar-parsedinclude">parsedinclude</a> and <a href="#skinvar-include">include</a> for other include options).
3109 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute)</li>
3114 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
3115 <li>Your file will be included using the standard php <code>include()</code> command. This command will be called from <em>inside</em> a class method, so <strong>you'll need to declare which global variables you want to access</strong> yourself. Most of the <a href="#skinvar-phpinclude-vars">standard variables</a> are automatically declared global by Nucleus itself.</li>
3126 <pre><code><%phpinclude(filename.php)%>
3127 <%phpinclude(/home/user/myself/filename.php)%></code></pre>
3134 <a name="skinvar-phpinclude-vars"></a>
3135 <h1>Skin/Templatevar: phpinclude : vars</h1>
3138 The following global variables are accessible from within files included by the <a href="#skinvar-phpinclude">phpinclude</a> skin/templatevar:
3142 $GATEWAY_INTERFACE, $SERVER_NAME, $SERVER_SOFTWARE
3143 <br />$SERVER_PROTOCOL, $REQUEST_METHOD, $QUERY_STRING
3144 <br />$DOCUMENT_ROOT, $HTTP_ACCEPT, $HTTP_ACCEPT_CHARSET
3145 <br />$HTTP_ACCEPT_ENCODING, $HTTP_ACCEPT_LANGUAGE
3146 <br />$HTTP_CONNECTION, $HTTP_HOST, $HTTP_REFERER
3147 <br />$HTTP_USER_AGENT, $REMOTE_ADDR, $REMOTE_PORT
3148 <br />$SCRIPT_FILENAME, $SERVER_ADMIN, $SERVER_PORT
3149 <br />$SERVER_SIGNATURE, $PATH_TRANSLATED, $SCRIPT_NAME
3150 <br />$REQUEST_URI, $argv, $argc, $PHP_SELF
3151 <br />$HTTP_COOKIE_VARS, $HTTP_GET_VARS, $HTTP_POST_VARS
3152 <br />$HTTP_POST_FILES, $HTTP_ENV_VARS, $HTTP_SERVER_VARS
3153 <br />$HTTP_SESSION_VARS, $PATH_INFO, $HTTPS
3154 <br />$HTTP_RAW_POST_DATA, $HTTP_X_FORWARDED_FOR
3158 For others variables, you'll need to add '<tt>global $varname;</tt>' explicitly in your code
3166 <a name="skinvar-parsedinclude"></a>
3167 <h1>Skin/Templatevar: parsedinclude</h1>
3170 Includes a file into the output. The contents of the file is parsed by the Nucleus skin/template parser, so you can use skin/templatevars. (see <a href="#skinvar-phpinclude">phpinclude</a> and <a href="#skinvar-include">include</a> for other include options)
3175 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute)</li>
3180 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
3181 <li>From inside the included file, you can call <code><%parsedinclude(filename)%></code> again. To avoid endless loops, the maximum depth level you can go is 3.</li>
3194 <%parsedinclude(filename.txt)%>
3195 <%parsedinclude(/home/user/myself/filename.txt)%>
3206 <a name="skinvar-plugin"></a>
3207 <h1>Skin/Templatevar: plugin</h1>
3222 <td>Name of the plugin that should be called. <strong>This name is case sensitive!</strong></td>
3225 <li><p>Extra parameters can be added, depending on the plugin</p></li>
3230 <li>When a plugin name does not conflict with existing variables, it can be called directly using <code><%PluginName(parameters)%></code></li>
3242 <%plugin(Calendar)%>
3243 <%plugin(LastComments,myweblog)%>
3244 <%LastComments(myweblog)%>
3253 <a name="skinvar-loginform"></a>
3254 <h1>Skinvar: loginform</h1>
3256 <p>Adds a loginform, or shows a "You are karma (Log out)" message</p>
3269 <pre><code><%loginform%></code></pre>
3277 <a name="skinvar-commentform"></a>
3278 <h1>Skinvar: commentform</h1>
3281 Adds a commentform to an item page.
3288 <li><strong><em>destinationurl</em></strong>: sets the URL to where Nucleus needs to redirect after adding the comment (by default, Nucleus redirects to the item detail page for the item)</li>
3301 <%commentform%>
3302 <%commentform(http://host/thanks.html)%>
3310 <a name="skinvar-set"></a>
3311 <h1>Skin/Templatevar: set</h1>
3314 Sets a <a href="#parser-properties" title="A list of available parser properties">parser property</a>.
3320 <li><strong>property</strong>: name of the property</li>
3321 <li><strong>value</strong>: value of the property</li>
3334 <%set(IncludeMode,skindir)%>
3335 <%set(IncludePrefix,somedir/)%>
3342 <a name="skinvar-skinfile"></a>
3343 <h1>Skin/Templatevar: skinfile</h1>
3345 <p>Used by imported skins to put a link relative to the skins-URL. Use it in conjunction with the <tt>IncludePrefix</tt> <a href="#parser-properties">parser property</a> to get the best results</p>
3350 <li><strong>filename</strong>: filename of which you want the correct URL</li>
3363 <%skinfile(mystyle.css)%>
3371 <a name="skinvar-skinname"></a>
3372 <h1>Skin/Templatevar: skinname</h1>
3374 <p>Inserts the name of the skin that's currently being used.</p>
3398 <a name="skinvar-if"></a>
3399 <a name="skinvar-else"></a>
3400 <a name="skinvar-endif"></a>
3401 <a name="skinvar-ifnot"></a>
3402 <a name="skinvar-elseifnot"></a>
3403 <a name="skinvar-elseif"></a>
3404 <h1>Skinvars: if/ifnot/else/elseif/elseifnot/endif</h1>
3406 <p>Inserts a content block only when certain conditions are fullfilled. Can be used in the item and comment fields of templates as of 3.60, as well as in Item bodies (same as item template fields).</p>
3409 <p>Only the <code>if</code>, <code>ifnot</code>, <code>elseif</code>, and <code>elseifnot</code> skinvars have options</p>
3413 <li><strong>type</strong>: type of condition</li>
3414 <li><em>name</em>: name of option (optional)</li>
3415 <li><em>value</em>: value to be checked (optional)</li>
3418 <h2>Condition types</h2>
3421 <li><strong>category</strong>: condition is fullfilled when a category is selected
3423 <li><strong>category</strong>: checks if any category is selected</li>
3424 <li><strong>category,catname,<em>CategoryName</em></strong>: checks if the current category is <em>CategoryName</em></li>
3425 <li><strong>category,catid,<em>CategoryId</em></strong>: checks if the current category is <em>CategoryId</em></li>
3428 <li><strong>blogsetting</strong>: checks if the value <em>name</em> blogsetting equals <em>value</em> (the name is the column name from the nucleus_blog sql table)</li>
3429 <li><strong>loggedin</strong>: condition is fullfilled if visiting member is currently logged in</li>
3430 <li><strong>onteam</strong>: condition is fullfilled if visiting member is currently logged in & member of the blog team of the current blog (or the blog given in the <em>name</em> parameter)</li>
3431 <li><strong>admin</strong>: condition is fullfilled if visiting member is currently logged in & member with blog admin rights to the current blog (or the blog given in the <em>name</em> parameter)</li>
3432 <li><strong>nextitem</strong>: true if there is a more recent item available for the current weblog (item skintype)</li>
3433 <li><strong>previtem</strong>: true if there is an older item available for the current weblog (item skintype)</li>
3434 <li><strong>archivenextexists</strong>: true if there is a more recent archive available for the current weblog (archive skintype)</li>
3435 <li><strong>archiveprevexists</strong>: true if there is an older archive available for the current weblog (archive skintype)</li>
3436 <li><strong>skintype</strong>: checks if the current skin type is equal to <em>value</em> (index, search, item, archive, archivelist, ...). For special skin parts, the skin type is the name of the special skin part.</li>
3437 <li><strong>hasplugin</strong>: checks if the a plugin is installed, or if a plugin option has been set to a specific value
3439 <li><strong>hasplugin,<em>PluginName</em></strong>: checks if plugin is available</li>
3440 <li><strong>hasplugin,<em>PluginName</em>,<em>OptionName</em></strong>: checks if a plugin option is not set to 'no'</li>
3441 <li><strong>hasplugin,<em>PluginName</em>,<em>OptionName=value</em></strong>: checks if a plugin option is set to a specific value</li>
3444 <li><strong><em>PluginName</em></strong>: checks if the a plugin is installed, and executes doIf() method of plugin to check condition of name/value pair. This allows plugins to do conditional checks in a skin. See documentation for your plugin to determine what conditionals it can perform and the syntax required for its use.
3446 <li><strong><em>PluginName</em>,<em>AttributeName</em></strong>: uses <em>PluginName</em> plugin to check if <em>AttributeName</em> has empty value</li>
3447 <li><strong><em>PluginName</em>,<em>AttributeName</em>,<em>AttributeValue</em></strong>: uses <em>PluginName</em> plugin to check if <em>AttributeName</em> is <em>AttributeValue</em></li>
3450 <li><strong>itemcategory</strong>: checks conditions related to the category of the current item (item and comment template fields only)
3452 <li><strong>itemcategory</strong>: checks if current item has a category (always true)</li>
3453 <li><strong>itemcategory,catname,<em>CategoryName</em></strong>: checks if the category of the current item is <em>CategoryName</em></li>
3454 <li><strong>itemcategory,catid,<em>CategoryId</em></strong>: checks if the id of the item's category is <em>CategoryId</em></li>
3457 <li><strong>itemblogsetting</strong>: checks if the value <em>name</em> blogsetting of the current item's blog equals <em>value</em> (the name is the column name from the nucleus_blog sql table) (item and comment template fields only)</li>
3458 <li><strong>author</strong>: checks conditions related to the author of the current item (item and comment template fields only)
3460 <li><strong>author</strong>: checks if the current visitor is the author of the item</li>
3461 <li><strong>author,isadmin</strong>: checks if the author of the item is an admin of the blog</li>
3462 <li><strong>author,name,<em>AuthorName</em></strong>: checks if the user name of the item's author is <em>AuthorName</em></li>
3463 <li><strong>author,isauthor</strong>: checks if the comment author is also the author of the item. (comment template fields only)</li>
3464 <li><strong>author,isonteam</strong>: checks if the comment author is a member of blog team of current item. (comment template fields only)</li>
3479 <%if(loggedin)%>
3487 <%if(category,catname,Off Topic)%>
3488 Welcome to the 'Off Topic' category.
3493 <%ifnot(loggedin)%>
3495 <%elseif(admin)%>
3496 Welcome O Mighty Admin of this Blog!
3497 <%elseif(onteam)%>
3498 Welcome O Worthy Blog Team Member!
3500 Welcome O Humble Site Member!
3506 <p>If you want something to be displayed only if a condition is not fullfilled, you can use a construct like this:</p>
3509 <%ifnot(skintype,error)%>
3510 <%blogsetting(name)%>
3522 <a name="skinvar-membermailform"></a>
3523 <h1>Skinvar: membermailform</h1>
3526 Shows a form through which a logged-in member can send a message to the member which details are being shown (on member detail pages)
3533 <li><strong><em>rows</em></strong>: Amount of rows in the box (default = 10)</li>
3534 <li><strong><em>cols</em></strong>: Amount of columns in the box (default = 40)</li>
3535 <li><strong><em>destination url</em></strong>: URL to where Nucleus needs to redirection after sending the message</li>
3548 <%membermailform%>
3559 <a name="skinvar-searchform"></a>
3560 <h1>Skinvar: searchform</h1>
3563 Shows a search form for the current blog.
3570 <li><strong><em>blogname</em></strong>: The name of the blog for which you want a search form (short blog name)</li>
3577 index, archive, archivelist, search, item
3583 <%searchform%>
3584 <%searchform(otherweblog)%>
3595 <a name="skinvar-nucleusbutton"></a>
3596 <h1>Skinvar: nucleusbutton</h1>
3598 <p>Inserts a nucleus button, with link to the <a href="http://nucleuscms.org/" class="out" onclick="window.open(this.href);return false;" title="Nucleus website (opens in new window)">Nucleus website</a>.</p>
3604 <li><strong><em>imgurl</em></strong>: URL of the image (if you don't want the default)</li>
3605 <li><strong><em>imgwidth</em></strong>: width of the image (in pixels)</li>
3606 <li><strong><em>imgheight</em></strong>: height of the image (in pixels)</li>
3612 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
3624 <%nucleusbutton%>
3625 <%nucleusbutton(nucleus/nucleus.gif,46,43)%>
3634 <a name="skinvar-self"></a>
3635 <h1>Skinvar: self</h1>
3638 Inserts the filename of the page currently being displayed (index.php or whatever you changed it to)
3660 <a name="skinvar-addlink"></a>
3661 <h1>Skinvar: addlink</h1>
3664 Inserts a URL to the new item bookmarklet form. Only shown for members who have rights on the current blog.
3679 <dd><a href="<%addlink%>" onclick="<%addpopupcode%>" title="Add an item to your blog">Add an item</a></dd>
3685 <a name="skinvar-addpopupcode"></a>
3686 <h1>Skinvar: addpopupcode</h1>
3689 Inserts javascript code to open a bookmarklet in an popup window. Use with <code><%addlink%></code>
3704 <dd><a href="<%addlink%>" onclick="<%addpopupcode%>" title="Add an item to your blog">Add an item</a></dd>
3711 <a name="skinvar-sticky"></a>
3712 <h1>Skinvar: sticky</h1>
3715 Inserts the indicated item into the skin.
3722 <li><strong>itemid</strong>: id of the item to show</li>
3723 <li><strong>template</strong>: name of the template to use</li>
3736 <%sticky(11,default/index)%>
3744 <a name="templatevars-overview"></a>
3745 <h1>Template variables: Overview</h1>
3749 <p>Template variables largely work in exact the same way as skin variables, with the only difference that they are being used inside templates. The variables are called using <code><%<i>varname</i>%></code>, and include some text depending on the variable function. Some variables also have extra optional parameters.</p>
3751 <h2>Available variables</h2>
3754 These template variables be used in the following template-parts: <tt>item header, item body, item footer, date header, date footer, morelink, editlink</tt> (The variables <tt>image</tt>, <tt>popup</tt> and <tt>media</tt> can also be used inside weblog items.)
3758 <li><a href="#templatevars-basic">Basic variables...</a> (title, body, ...)</li>
3759 <li><a href="#templatevars-advanced">Advanced variables...</a> (include, plugin, ...)</li>
3762 <p>Comments-related template-parts (<tt>comments header, comments body, comments footer, one comment, two comments, comments read more, no comments, too much comments</tt>) have a different set of available variables:</p>
3765 <li><a href="#templatevars-comments">Comments-related variables...</a></li>
3774 <a name="templatevars-basic"></a>
3775 <h1>Template variables: Basic variables</h1>
3777 <p>All these variables concern the item that's currently being parsed.</p>
3781 <th>Description</th>
3790 <td>extended text</td>
3793 <td>name of the category</td>
3795 <td>categorylink</td>
3796 <td>raw link to the category</td>
3798 <td><a href="#templatevar-karma">karma</a></td>
3799 <td>karma score</td>
3802 <td>raw link to the author</td>
3805 <td>raw permanent link for the item</td>
3807 <td><a href="#templatevar-author">author</a></td>
3808 <td>name of the author</td>
3810 <td><a href="#templatevar-smartbody">smartbody</a></td>
3811 <td>either the body text or the extended text</td>
3813 <td><a href="#templatevar-morelink">morelink</a></td>
3814 <td>'read more'-link</td>
3816 <td><a href="#templatevar-date">date</a></td>
3817 <td>Formatted date</td>
3819 <td><a href="#templatevar-time">time</a></td>
3820 <td>Formatted time</td>
3823 <td>raw link to the daily archive</td>
3825 <td><a href="#templatevar-comments">comments</a></td>
3826 <td>comments block or commentcount</td>
3829 <td>ID of the item</td>
3832 <td>URL of the blog</td>
3835 <p><a href="#templatevars-overview">Template variables overview...</a></p>
3843 <a name="templatevars-advanced"></a>
3844 <h1>Template variables: Advanced variables</h1>
3849 <th>Description</th>
3852 <td>ID of the current items author</td>
3855 <td>ID of the blog</td>
3858 <td>ID of the category for the current item</td>
3861 <td>search query (if there is one)</td>
3863 <td><a href="#templatevar-syndicate_title">syndicate_title</a></td>
3864 <td>Syndicated title</td>
3866 <td><a href="#templatevar-syndicate_description">syndicate_description</a></td>
3867 <td>Syndicated body text</td>
3869 <td>karmaposlink</td>
3870 <td>raw vote link</td>
3872 <td>karmaneglink</td>
3873 <td>raw vote link</td>
3876 <td>'New Item!'-text</td>
3878 <td><a href="#skinvar-include">include</a></td>
3879 <td>includes a file, whithout parsing</td>
3881 <td><a href="#skinvar-parsedinclude">parsedinclude</a></td>
3882 <td>includes a file, parsing it</td>
3884 <td><a href="#skinvar-phpinclude">phpinclude</a></td>
3885 <td>includes a file, parsing by PHP</td>
3887 <td><a href="#skinvar-if">if-ifnot-else-elseif-elseifnot-endif</a></td>
3888 <td>performs condition statements in templates (3.60)</td>
3890 <td><a href="#skinvar-plugin">plugin</a></td>
3891 <td>executes a plugin</td>
3893 <td><a href="#templatevar-edit">edit</a></td>
3894 <td>inserts an 'edit this item' link</td>
3896 <td><a href="#templatevar-editlink">editlink</a></td>
3897 <td>raw 'edit item' link (links to bookmarklet)</td>
3899 <td><a href="#templatevar-editpopupcode">editpopupcode</a></td>
3900 <td>javascript code to open a popup window for editlink</td>
3902 <td><a href="#skinvar-skinfile">skinfile</a></td>
3903 <td>includes the correct URL for a file belonging to an imported skin</td>
3905 <td><a href="#skinvar-set">set</a></td>
3906 <td>sets a parser property</td>
3908 <td><a href="#templatevar-image">image</a></td>
3909 <td>inline image from media library</td>
3911 <td><a href="#templatevar-popup">popup</a></td>
3912 <td>popup image from media dir</td>
3914 <td><a href="#templatevar-media">media</a></td>
3915 <td>other media object from media dir</td>
3918 <td>Includes the 'search hit relevance' in templates that display search results</td>
3921 <p><a href="#templatevars-overview">Template variables overview...</a></p>
3929 <a name="templatevars-comments"></a>
3930 <h1>Template variables: Comments</h1>
3935 <th>Description</th>
3938 <td>comment body</td>
3944 <td>users URL or e-mail address</td>
3947 <td>a smart link to either the e-mail or URL for non members, or the member detail page for members. Note: this link already includes the <a href="..."> and </a> tags ! (when no valid URL or e-mail is available, only the name of the member will be shown)</td>
3949 <td>userlinkraw</td>
3950 <td>same as above, but without the <a href.., empty when no valid URL or e-mail available</td>
3953 <td>the e-mail address of the user, empty if the e-mail address was not provided by the user</td>
3955 <td>userwebsite</td>
3956 <td>the URL of the users website, empty if the URL was not provided by the user</td>
3958 <td>userwebsitelink</td>
3959 <td>a smart link to URL for non members, or the member detail page for members. Note: this link already includes the <a href="..."> and </a> tags ! (when no valid URL, only the name of the member will be shown)</td>
3962 <td>ID of the member (0 for non-members)</td>
3964 <td>commentcount</td>
3965 <td>total amount of comments for the item</td>
3967 <td><a href="#templatecommentwords" title="commentword()">commentword</a></td>
3968 <td>1 'comment', 2 'comments'</td>
3970 <td><a href="#templatevar-date" title="date([format])">date</a></td>
3971 <td>date on which comment was added</td>
3973 <td><a href="#templatevar-time" title="time([format])">time</a></td>
3974 <td>time at which comment was added</td>
3977 <td>host from where comment was added</td>
3980 <td>IP-address from where comment was added</td>
3983 <td>ID of the current comment</td>
3986 <td>ID of the current item</td>
3989 <td>link to the detailed item page</td>
3991 <td><a href="#templateitemtitle" title="itemtitle([maxlength])">itemtitle</a></td>
3992 <td>Title of the current item</td>
3995 <td>ID of the weblog</td>
3998 <td>URL of the weblog</td>
4000 <td><a href="#templatememberextra" title="authtext()">authtext</a></td>
4001 <td>the extra text for members, empty for non members</td>
4004 <td>a cut off version of the body, which truncates after the first line break. <a href="#templatecommentcontinued">A link is added</a> at the end according to the template</td>
4007 <td>the body of the comment, cut at 60 characters and appended with '...'</td>
4010 <td>time at which comment was added</td>
4012 <td><a href="#skinvar-if">if-ifnot-else-elseif-elseifnot-endif</a></td>
4013 <td>performs condition statements in templates (3.60)</td>
4015 <td><a href="#skinvar-include" title="include(filename)">include</a></td>
4016 <td>includes a file, whithout parsing</td>
4018 <td><a href="#skinvar-parsedinclude" title="parsedinclude(filename)">parsedinclude</a></td>
4019 <td>includes a file, parsing it</td>
4021 <td><a href="#skinvar-phpinclude" title="phpinclude(filename)">phpinclude</a></td>
4022 <td>includes a file, parsing by PHP</td>
4024 <td><a href="#skinvar-plugin" title="plugin(name,[options...])">plugin</a></td>
4025 <td>executes a plugin</td>
4027 <td><a href="#skinvar-skinfile" title="skinfile(filename)">skinfile</a></td>
4028 <td>includes the correct URL for a file belonging to an imported skin</td>
4030 <td><a href="#skinvar-set" title="set(property,value)">set</a></td>
4031 <td>sets a parser property</td>
4036 <p><a href="#templatevars-overview">Template variables overview...</a></p>
4043 <a name="templatevar-karma"></a>
4044 <h1>Templatevar: karma</h1>
4046 <p>Inserts karma votes data. Karma votes are a method to vote the 'karma' of an item. With a single click, the visitor can vote either positive or negative. The total of all these votes gives an idea of how much an item is liked by the visitors</p>
4053 <li><strong><em>what</em></strong>: Choose a type of information to be displayed:
4055 <li><strong>totalscore</strong>: the total karma vote score (=amount of positive votes minus the amount of negative votes) <em>(default)</em></li>
4056 <li><strong>pos</strong>: total number of positive votes</li>
4057 <li><strong>neg</strong>: total number of negative votes</li>
4058 <li><strong>votes</strong>: total number of votes</li>
4059 <li><strong>posp</strong>: percentage of votes that is positive</li>
4060 <li><strong>negp</strong>: percentage of votes that is negative</li>
4067 <pre><code><%karma(posp)%> out of <%karma(votes)%> were positive</code></pre>
4075 <a name="templateitemtitle"></a>
4076 <h1>Templatevar: templateitemtitle</h1>
4078 <p>On comments-releated templateparts, inserts the title of the associated item.</p>
4084 <li><strong><em>maxlength</em></strong>: When provided, makes the itemtitle behave like the <a href="#templatevar-syndicate_title">syndicate_title templatevar</a>.
4097 <a name="templatevar-author"></a>
4098 <h1>Templatevar: author</h1>
4100 <p>Inserts the name of the author</p>
4105 <li><strong><em>what</em></strong>: Choose a type of information to be displayed:
4107 <li><strong>name</strong>: display name <em>(default)</em></li>
4108 <li><strong>realname</strong>: the real name of the author instead of the display name</li>
4109 <li><strong>id</strong>: Nucleus membet ID</li>
4110 <li><strong>url</strong>: URL of members website</li>
4111 <li><strong>email</strong>: email address of member (use of this one should be avoided)</li>
4119 <pre><code><%author%>
4120 <%author(realname)%>
4121 <a href="<%author(url)%>"><%author%></a></code></pre>
4129 <a name="templatevar-smartbody"></a>
4130 <h1>Templatevar: smartbody</h1>
4133 Examines the current item and then decides to show either the body text or the expanded text.
4136 <p>When the extended part is empty, the body part is chosen. Otherwise the extended part is shown.</p>
4138 <table style="text-align: center;"><tr>
4139 <th>Part</th><th colspan="2">Empty?</th>
4141 <td>Body</td><td>No</td><td>No</td>
4143 <td>Extended</td><td>Yes</td><td>No</td>
4145 <th>smartbody=</th><th>body part</th><th>extended part</th>
4148 <h2>Example use</h2>
4150 <p>The body text could be interpreted as your full text, and the extended part could be interpreted as an 'introduction' or 'exerpt', which you want to show on the front page.</p>
4151 <p>In the template used on the front page, you would use <tt><%smartbody%></tt> to insert an excerpt (if there is one), or the full text (if no excerpt). In the template for detailed items, <tt><%body%></tt> can then be used instead of the usual <tt><%body%></tt> + <tt><%more%></tt>, since <tt><%body%></tt> will contain the full item anyway.</p>
4160 <a name="templatevar-morelink"></a>
4161 <h1>Templatevar: morelink</h1>
4164 Inserts a link to the detail page for the item, as defined in the template (<a href="#templatemorelink">link to extended entry</a>). This is empty when there is no extended part.
4167 <p>Note that the contents of the 'link to extended entry' templatepart is also parsed and can thus also contain <a href="#templatevars-overview">templatevariables</a>.</p>
4172 <a name="templatevar-date"></a>
4173 <h1>Templatevar: date</h1>
4176 Inserts a date using the <a href="#templatedatetime">date format specified in the template</a>. Optionally, a custom date format can be given as a parameter.
4182 <li><strong><i>format</i></strong>: format to be used to format the date</li>
4188 <p>Four special parameters are possible:</p>
4190 <li><code>rfc822</code>: RFC822 date in local time</li>
4191 <li><code>rfc822GMT</code>: RFC date in GMT time</li>
4192 <li><code>iso8601</code>: ISO-8601 date (<a href="http://www.w3.org/TR/NOTE-datetime">W3C Date and Time Format</a> profile). Example: 2002-10-02T10:00:00-05:00</li>
4193 <li><code>utc</code>: Same as iso8601, but the date is expressed in UTC, using a "Z" for the timezone indicator.</li>
4200 <%date(rfc822)%>
4201 <%date(rfc822GMT)%>
4208 <a name="templatevar-time"></a>
4209 <h1>Templatevar: time</h1>
4212 Inserts a time using the <a href="#templatedatetime">time format specified in the template</a>. Optionally, a custom time format can be given as a parameter.
4218 <li><strong><i>format</i></strong>: format to be used to format the time</li>
4232 <a name="templatevar-comments"></a>
4233 <h1>Templatevar: comments</h1>
4236 Inserts a comments 'block'. <a href="#templatecomments">More information about the structure of this block</a>.
4246 <td>Amount of comments to show (when set, this overrides the <a href="#blogmaxcomments">max. comments blogsetting</a>)</td>
4254 <%comments(5)%>
4261 <a name="templatevar-syndicate_title"></a>
4262 <h1>Templatevar: syndicate_title</h1>
4265 Inserts the title of the item, with HTML tags-stripped off, and shortened to 100 characters. When the text needs to be shortened, "..." is added at the end of the text.
4269 This variable was originally intended for use in the XML-RSS skin that comes with Nucleus, but can also be of use in other situations.
4281 <td>Maximum amount of characters to keep (defaults to 100)</td>
4289 <%syndicate_title%>
4290 <%syndicate_title(25)%>
4296 <a name="templatevar-syndicate_description"></a>
4297 <h1>Templatevar: syndicate_description</h1>
4300 Inserts the body of the item, with HTML tags-stripped off, and shortened to 250 characters. When the text needs to be shortened, "..." is added at the end of the text.
4304 This variable was originally intended for use in the XML-RSS skin that comes with Nucleus, but can also be of use in other situations.
4316 <td>Maximum amount of characters to keep (defaults to 250)</td>
4324 <%syndicate_description%>
4325 <%syndicate_description(25)%>
4332 <a name="templatevar-image"></a>
4333 <h1>Templatevar: image</h1>
4335 <p>Inserts an inline image into an item body or template.</p>
4337 <p>In normal use, the image-templatevar is generated automatically when adding images through the media library. You can call it from within templates too, though. Note that in this last case, the image will come out of the media dir of the current item's author.</p>
4348 <td>Name of the image file (file gets)</td>
4351 <td>Width of the image (pixels or percentage)</td>
4354 <td>Height of the image</td>
4357 <td>alt-text for the image</td>
4360 <li><strong>Note:</strong> for the image, popup and media tags, the parameters must be separated by the '|' character, <em>not</em> by a comma!</li>
4366 <%image(myphoto.jpg|100|200|this is me)%>
4367 <%image(myphoto.jpg|50%|50%|this is me, but smaller)%>
4375 <a name="templatevar-popup"></a>
4376 <h1>Templatevar: popup</h1>
4378 <p>Inserts a popup image into an item body or template.</p>
4380 <p>In normal use, the popup-templatevar is generated automatically when adding images through the media library. You can call it from within templates too, though. Note that in this last case, the image will come out of the media dir of the current item's author.</p>
4391 <td>Name of the image file (file gets)</td>
4394 <td>Width of the image (pixels or percentage)</td>
4397 <td>Height of the image</td>
4400 <td>alt-text for the image</td>
4403 <li><strong>Note:</strong> for the image, popup and media tags, the parameters must be separated by the '|' character, <em>not</em> by a comma!</li>
4409 <%popup(myphoto.jpg|100|200|this is me)%>
4410 <%popup(myphoto.jpg|50%|50%|this is me, but smaller)%>
4418 <a name="templatevar-media"></a>
4419 <h1>Templatevar: media</h1>
4421 <p>Inserts a media object into an item body or template.</p>
4423 <p>In normal use, the media-templatevar is generated automatically when adding images through the media library. You can call it from within templates too, though. Note that in this last case, the object will come out of the media dir of the current item's author.</p>
4434 <td>Name of the image file (file gets)</td>
4437 <td>descriptive text for the media object</td>
4440 <li><strong>Note:</strong> for the image, popup and media tags, the parameters must be separated by the '|' character, <em>not</em> by a comma!</li>
4445 <pre><code><%media(mysong.mp3|listen to my new song)%></code></pre>
4451 <a name="templatevar-edit"></a>
4452 <h1>Templatevar: edit</h1>
4455 From within your template, you can add an 'edit item' link by using this template variable. By default, it will link to a popup-bookmarklet-window, but that behaviour can be changed through the <a href="#templateeditlink">editlink template</a>.
4458 <p><strong>Note:</strong> only logged in members that are allowed to edit the item will see this link. In other cases, the edit-templatevar does nothing at all.</p>
4461 <p>An example for the item body template</p>
4462 <pre><code><h1><%title%></h1>
4463 <p><%body%> <%morelink%></p>
4464 <div class="metadata">
4465 <%edit%> <%comments%>
4466 </div></code></pre>
4470 <div class="example">
4471 <h4 style="margin:2px;">Title</h4>
4472 <p style="margin:2px;">This is an item</p>
4473 <div style="margin:2px;"><a href="#templatevar-edit">edit</a> - <a href="#templatevar-edit">5 comments</a></div>
4480 <a name="templatevar-editlink"></a>
4481 <h1>Templatevar: editlink</h1>
4484 Insert a link to the 'edit item' bookmarklet. This can be used in the <a href="#templateeditlink">editlink template</a> for simplicity.
4489 <p>The <a href="#templateeditlink">'edit link'-template</a> could look like this:</p>
4491 <a href="<%editlink%>"
4492 onclick="<%editpopupcode%>">edit</a> -
4499 <a name="templatevar-editpopupcode"></a>
4500 <h1>Templatevar: editpopupcode</h1>
4503 To open a popup window for the 'edit link' window, you'll need to add some javascript code to your link. To avoid having to enter this code in the 'edit link'-template, you can insert it using the editpopupcode-templatevar.
4507 <p>See the example for the <a href="#templatevar-editlink">editlink templatevar</a></p>
4513 <a name="plugins"></a>
4516 Nucleus allows you to install custom plugins, adding extra functionality. Plugins can do different things:
4519 <li>Act as a skin variable</li>
4520 <li>Act as a template variable</li>
4521 <li>Hook into events generated by Nucleus. The 'move up' and 'move down' links in 'manage plugins' screen can be used to define the order in which plugins will be called when such an event occurs. The first plugin in the list will be called first, the last one will be called last.</li>
4522 <li>Act as actors when called through <tt>action.php</tt></li>
4525 Note that the responsibility for plugins is entirely with the plugin author. He should make sure that everything works fine.
4527 <a name="getplugins"></a>
4529 There are two main repositories where you can find plugins for Nucleus CMS:
4532 <li><a href="http://wiki.nucleuscms.org/plugin" title="Plugin Wiki">English</a></li>
4533 <li><a href="http://japan.nucleuscms.org/wiki/plugins" title="Japanese Plugin Wiki">Japanese</a></li>
4536 Neither or these repositories is entirely complete. You will find some plugins in one, but not in the other, and vice versa.
4537 Do not be scared off of one or the other on account of locale, as there are a few free translation services on the Internet that
4538 will help you get by.
4540 Another resource that will help you while working with plugins is the search function at the
4541 <a href="http://forum.nucleuscms.org/" title="Support Forum">support forum</a>. You will even find some
4542 smaller plugins on the forum that never made it to the wiki.
4548 <a name="parser-properties"></a>
4549 <a name="includemode"></a>
4550 <a name="includeprefix"></a>
4551 <h1>Parser Properties</h1>
4553 <p>The available parser options are described below.</p>
4556 <caption>Parser properties</caption>
4558 <th>Option Name</th>
4561 <td>IncludeMode</td>
4564 <li><strong>normal</strong>: normal behaviour; included files are taken relative to the directory/url of the .php file generating the page.</li>
4565 <li><strong>skindir</strong>: included files are taken relative to the skindir/skinurl</li>
4567 <p>This property affects the following skinvars: <a href="#skinvar-include">include</a>, <a href="#skinvar-phpinclude">phpinclude</a>, <a href="#skinvar-parsedinclude">parsedinclude</a>, <a href="#skinvar-nucleusbutton">nucleusbutton</a></p>
4570 <td>IncludePrefix</td>
4572 <p>This property is a prefix that get's added in front of each filename you want to include. For example, if the prefix is <tt>base/</tt> and you want to include <tt>somefile.txt</tt>, you'll end up including <tt>base/somefile.txt</tt></p>
4573 <p>This property is intended to be used in conjunction with the IncludeMode property. This way, a skin imported to <tt><em>skindir/</em>somename/</tt> can set <tt>IncludeMode</tt> to <tt>skindir</tt> and <tt>IncludePrefix</tt> to <tt>somename/</tt></p>
4574 <p>This property affects the following skinvars: <a href="#skinvar-include">include</a>, <a href="#skinvar-phpinclude">phpinclude</a>, <a href="#skinvar-parsedinclude">parsedinclude</a>, <a href="#skinvar-nucleusbutton">nucleusbutton</a></p>
4579 <p>The <tt>IncludePrefix</tt> and <tt>IncludeMode</tt> properties can be set globally for a skin in the general settings of a skin. Also note that from the moment a property is set, it applies to all parsed data, thus also for templates.</p>
4584 <a id="adminskinvar-actionurl" name="adminskinvar-actionurl"></a>
4585 <h1>AdminSkinvar: actionurl</h1>
4586 <p>The contents of $CONF['ActionURL'] are indicated.</p>
4598 <a id="adminskinvar-addtickettourl" name="adminskinvar-addtickettourl"></a>
4599 <h1>AdminSkinvar: addtickettourl</h1>
4600 <p>A ticket is added to URL to which it was given.</p>
4607 <%addtickettourl(index.php)%>
4612 <a id="adminskinvar-adminurl" name="adminskinvar-adminurl"></a>
4613 <h1>AdminSkinvar: adminurl</h1>
4614 <p>The contents of $CONF['AdminURL'] are indicated.</p>
4626 <a id="adminskinvar-codename" name="adminskinvar-codename"></a>
4627 <h1>AdminSkinvar: codename</h1>
4628 <p>The contents of $nucleus['codename'] are indicated.</p>
4640 <a id="adminskinvar-date" name="adminskinvar-date"></a>
4641 <h1>AdminSkinvar: date</h1>
4642 <p>Formatted datetime is indicated.</p>
4654 <a id="adminskinvar-extrahead" name="adminskinvar-extrahead"></a>
4655 <h1>AdminSkinvar: extrahead</h1>
4656 <p>The contents of extra <head> contents are indicated.</p>
4668 <a id="adminskinvar-headmessage" name="adminskinvar-headmessage"></a>
4669 <h1>AdminSkinvar: headmessage</h1>
4670 <p>Adminpagr headmessage is indicated.</p>
4677 <%headmessage%>
4682 <a id="adminskinvar-helplink" name="adminskinvar-helplink"></a>
4683 <h1>AdminSkinvar: helplink</h1>
4684 <p>Link to help topic is indicated.</p>
4691 <%helplink(adminskinvar-helplink)%>
4696 <a id="adminskinvar-member" name="adminskinvar-member"></a>
4697 <h1>AdminSkinvar: member</h1>
4698 <p>Member information is indicated.</p>
4706 <td>Display name of member</td>
4709 <td>Real name of member</td>
4712 <td>Notes of member</td>
4715 <td>Site URL of member</td>
4718 <td>E-mail of member</td>
4721 <td>ID of member</td>
4724 <td>Display name of reading member</td>
4726 <td>yourrealname</td>
4727 <td>Real name of reading member</td>
4730 <td>Notes of reading member</td>
4733 <td>Site URL of reading member</td>
4736 <td>E-mail of reading member</td>
4739 <td>ID of reading member</td>
4741 <td>yourprofileurl</td>
4742 <td>Profile page URL of reading member</td>
4748 <%member(realname)%>
4753 <a id="adminskinvar-newestcompare" name="adminskinvar-newestcompare"></a>
4754 <h1>AdminSkinvar: newestcompare</h1>
4755 <p>I inquire whether the version of the core file is the latest edition.</p>
4762 <%newestcompare%>
4767 <a id="adminskinvar-pagehead" name="adminskinvar-pagehead"></a>
4768 <h1>AdminSkinvar: pagehead</h1>
4769 <p>The contents of page header are indicated.</p>
4781 <a id="adminskinvar-pagefoot" name="adminskinvar-pagefoot"></a>
4782 <h1>AdminSkinvar: pagefoot</h1>
4783 <p>The contents of page footer are indicated.</p>
4795 <a id="adminskinvar-qmenuaddselect" name="adminskinvar-qmenuaddselect"></a>
4796 <h1>AdminSkinvar: qmenuaddselect</h1>
4797 <p>Selection box of the blog to which an item is added on the quick menu bar.</p>
4799 <p>Template name</p>
4804 <%qmenuaddselect(admin/default)%>
4809 <a id="adminskinvar-quickmenu" name="adminskinvar-quickmenu"></a>
4810 <h1>AdminSkinvar: quickmenu</h1>
4811 <p>The contents of quick menu bar are indicated.</p>
4813 <p>Template name</p>
4818 <%quickmenu(admin/default)%>
4823 <a id="adminskinvar-sitevar" name="adminskinvar-sitevar"></a>
4824 <h1>AdminSkinvar: sitevar</h1>
4825 <p>Site configuration vars are indicated.</p>
4833 <td>$CONF['IndexURL']</td>
4836 <td>$CONF['SiteName']</td>
4839 <td>$CONF['AdminEmail']</td>
4842 <td>$CONF['AdminURL']</td>
4848 <%sitevar(adminurl)%>
4853 <a id="adminskinvar-sprinttext" name="adminskinvar-sprinttext"></a>
4854 <h1>AdminSkinvar: sprinttext</h1>
4855 <p>A string produced according to the formatting string format.</p>
4857 <p>format(The fixed number or character string), args(value)</p>
4862 <%sprinttext(_PLUGIN_OPTIONS_TITLE,<|%geteditpluginfo(name)%|>)%>
4867 <a id="adminskinvar-ticket" name="adminskinvar-ticket"></a>
4868 <h1>AdminSkinvar: ticket</h1>
4869 <p>"type" the attribute, "hidden", a ticket is output by a input tag.</p>
4881 <a id="adminskinvar-version" name="adminskinvar-version"></a>
4882 <h1>AdminSkinvar: version</h1>
4883 <p>The contents of $nucleus['version'] are indicated.</p>
4895 <a id="adminskinvar-versioncheckurl" name="adminskinvar-versioncheckurl"></a>
4896 <h1>AdminSkinvar: versioncheckurl</h1>
4897 <p>URL of which I inquire a newest version of a core file is output.</p>
4904 <%versioncheckurl%>
4909 <a id="adminskinvar-benchmark" name="adminskinvar-benchmark"></a>
4910 <h1>AdminSkinvar: benchmark</h1>
4911 <p>Number of issuances of generation time from access starting to the place where this skin variable was written and a query is output.</p>
4923 <a id="adminskinvar-charset" name="adminskinvar-charset"></a>
4924 <h1>AdminSkinvar: charset</h1>
4925 <p>Character code for page indication.</p>
4937 <a id="adminskinvar-if" name="adminskinvar-if"></a>
4938 <a id="adminskinvar-else" name="adminskinvar-else"></a>
4939 <a id="adminskinvar-endif" name="adminskinvar-endif"></a>
4940 <a id="adminskinvar-ifnot" name="adminskinvar-ifnot"></a>
4941 <a id="adminskinvar-elseifnot" name="adminskinvar-elseifnot"></a>
4942 <a id="adminskinvar-elseif" name="adminskinvar-elseif"></a>
4943 <h1>AdminSkinvars: if/ifnot/else/elseif/elseifnot/endif</h1>
4945 <p>Inserts a content block only when certain conditions are fullfilled. Can be used in the item and comment fields of templates as of 3.60, as well as in Item bodies (same as item template fields).</p>
4948 <p>Only the <code>if</code>, <code>ifnot</code>, <code>elseif</code>, and <code>elseifnot</code> skinvars have options</p>
4952 <li><strong>type</strong>: type of condition</li>
4953 <li><em>name</em>: name of option (optional)</li>
4954 <li><em>value</em>: value to be checked (optional)</li>
4957 <h2>Condition types</h2>
4960 <li><strong>category</strong>: condition is fullfilled when a category is selected
4962 <li><strong>category</strong>: checks if any category is selected</li>
4963 <li><strong>category,catname,<em>CategoryName</em></strong>: checks if the current category is <em>CategoryName</em></li>
4964 <li><strong>category,catid,<em>CategoryId</em></strong>: checks if the current category is <em>CategoryId</em></li>
4967 <li><strong>blogsetting</strong>: checks if the value <em>name</em> blogsetting equals <em>value</em> (the name is the column name from the nucleus_blog sql table)</li>
4968 <li><strong>loggedin</strong>: condition is fullfilled if visiting member is currently logged in</li>
4969 <li><strong>onteam</strong>: condition is fullfilled if visiting member is currently logged in & member of the blog team of the current blog (or the blog given in the <em>name</em> parameter)</li>
4970 <li><strong>admin</strong>: condition is fullfilled if visiting member is currently logged in & member with blog admin rights to the current blog (or the blog given in the <em>name</em> parameter)</li>
4971 <li><strong>superadmin</strong>: condition is fullfilled if visiting member is currently logged in & member with admin rights to the site</li>
4972 <li><strong>nextitem</strong>: true if there is a more recent item available for the current weblog (item skintype)</li>
4973 <li><strong>previtem</strong>: true if there is an older item available for the current weblog (item skintype)</li>
4974 <li><strong>archivenextexists</strong>: true if there is a more recent archive available for the current weblog (archive skintype)</li>
4975 <li><strong>archiveprevexists</strong>: true if there is an older archive available for the current weblog (archive skintype)</li>
4976 <li><strong>skintype</strong>: checks if the current skin type is equal to <em>value</em> (index, search, item, archive, archivelist, ...). For special skin parts, the skin type is the name of the special skin part.</li>
4977 <li><strong>hasplugin</strong>: checks if the a plugin is installed, or if a plugin option has been set to a specific value
4979 <li><strong>hasplugin,<em>PluginName</em></strong>: checks if plugin is available</li>
4980 <li><strong>hasplugin,<em>PluginName</em>,<em>OptionName</em></strong>: checks if a plugin option is not set to 'no'</li>
4981 <li><strong>hasplugin,<em>PluginName</em>,<em>OptionName=value</em></strong>: checks if a plugin option is set to a specific value</li>
4984 <li><strong>adminaction</strong>: checks if the action query of URL is equal to <em>value</em>.</li>
4985 <li><strong>adminoldaction</strong>: checks if the original action query of URL is equal to <em>value</em>.</li>
4986 <li><strong>addresschange</strong>: checks if there change in the address of the member.</li>
4987 <li><strong>bechangepass</strong>: checks if have to change the password.</li>
4988 <li><strong>skincandidates</strong>: checks if skin overlap.</li>
4989 <li><strong>nameclashes</strong>: checks if member name overlap.</li>
4990 <li><strong>existsnewplugin</strong>: checks if plugin of non-installation in a plugin directory.</li>
4991 <li><strong>autosave</strong>: checks if autosave of the article which is being edited.</li>
4992 <li><strong>itemproperty</strong>: checks whether the contents of a property of an item "$name" are equal to $value.</li>
4998 <%if(superadmin)%>
4999 non-installed plugin list overview & installed plugin list overview
5001 installed plugin list overview only
5007 <a id="adminskinvar-include" name="adminskinvar-include"></a>
5008 <h1>AdminSkinvar: include</h1>
5010 Includes a textfile into the output. The contents of the file is not parsed in any way, so you cannot use skin/templatevars or use PHP code (see <a href="#adminskinvar-parsedinclude">parsedinclude</a> and <a href="#adminskinvar-phpinclude">phpinclude</a> if you want parsed includes)
5014 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute). Note that an URL can also be used here.</li>
5018 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
5024 <%include(filename.txt)%>
5025 <%include(/home/user/myself/filename.txt)%>
5026 <%include(http://mydomain.com/filename.html)%>
5031 <a id="adminskinvar-locale" name="adminskinvar-locale"></a>
5032 <h1>AdminSkinvar: locale</h1>
5033 <p>The present locale based on a site's establishing it is output.</p>
5045 <a id="adminskinvar-parsedinclude" name="adminskinvar-parsedinclude"></a>
5046 <h1>AdminSkinvar: parsedinclude</h1>
5047 <p>Includes a file into the output. The contents of the file is parsed by the Nucleus skin/template parser, so you can use skin/templatevars. (see <a href="#skinvar-phpinclude">phpinclude</a> and <a href="#skinvar-include">include</a> for other include options)</p>
5050 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute)</li>
5054 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
5055 <li>From inside the included file, you can call <code><%parsedinclude(filename)%></code> again. To avoid endless loops, the maximum depth level you can go is 3.</li>
5063 <%parsedinclude(filename.txt)%>
5064 <%parsedinclude(/home/user/myself/filename.txt)%>
5069 <a id="adminskinvar-phpinclude" name="adminskinvar-phpinclude"></a>
5070 <h1>AdminSkinvar: phpinclude</h1>
5071 <p>Includes a php-file into the output. The contents of the file is parsed by the PHP parser, so be careful. Nucleus skin/templatevars are <b>not</b> parsed! (see <a href="#skinvar-parsedinclude">parsedinclude</a> and <a href="#skinvar-include">include</a> for other include options).</p>
5074 <li><strong>filename</strong>: the name of the file to be included (either relative to the position of index.php, or absolute)</li>
5078 <li>This tag is affected by the <a href="#parser-properties">parser settings <code>IncludeMode</code> and <code>IncludePrefix</code></a></li>
5079 <li>Your file will be included using the standard php <code>include()</code> command. This command will be called from <em>inside</em> a class method, so <strong>you'll need to declare which global variables you want to access</strong> yourself. Most of the <a href="#skinvar-phpinclude-vars">standard variables</a> are automatically declared global by Nucleus itself.</li>
5085 <code><%phpinclude(filename.php)%>
5086 <%phpinclude(/home/user/myself/filename.php)%></code>
5091 <a id="adminskinvar-set" name="adminskinvar-set"></a>
5092 <h1>AdminSkinvar: set</h1>
5094 Sets a <a href="#parser-properties" title="A list of available parser properties">parser property</a>.
5099 <li><strong>property</strong>: name of the property</li>
5100 <li><strong>value</strong>: value of the property</li>
5107 <%set(IncludeMode,skindir)%>
5108 <%set(IncludePrefix,somedir/)%>
5113 <a name="adminskinvar-skinfile"></a>
5114 <h1>AdminSkinvar: skinfile</h1>
5115 <p>Used by imported skins to put a link relative to the skins-URL. Use it in conjunction with the <tt>IncludePrefix</tt> <a href="#parser-properties">parser property</a> to get the best results</p>
5119 <li><strong>filename</strong>: filename of which you want the correct URL</li>
5126 <%skinfile(mystyle.css)%>
5131 <a id="adminskinvar-text" name="adminskinvar-text"></a>
5132 <h1>AdminSkinvar: text</h1>
5133 <p>Constant which is already defined is output.</p>
5140 <%text(_ADMINPAGEFOOT_DONATE)%>
5145 <a id="adminskinvar-actionloglist" name="adminskinvar-actionloglist"></a>
5146 <h1>AdminSkinvar: actionloglist</h1>
5147 <p>actionloglist is output.</p>
5156 <%actionloglist(admin/default)%>
5162 <a id="adminskinvar-activationmessage" name="adminskinvar-activationmessage"></a>
5163 <h1>AdminSkinvar: activationmessage</h1>
5164 <p>activationmessage is output.</p>
5169 <li>type:template type
5171 <li>title:activation welcome message</li>
5172 <li>body:activation confirming message</li>
5173 <li>ackey:activation key</li>
5176 <li>TemplateName:template name</li>
5185 <%activationmessage(text,admin/default)%>
5191 <a id="adminskinvar-eventformextra" name="adminskinvar-eventformextra"></a>
5192 <h1>AdminSkinvar: eventformextra</h1>
5193 <p>Make a formextra event occur.</p>
5198 <li>activation : for activate skintype.</li>
5199 <li>membermailform-notloggedin : for createaccountinput skintype.</li>
5206 <li>createaccountinput</li>
5211 <%eventformextra(activation)%>
5217 <a id="adminskinvar-getblogsetting" name="adminskinvar-getblogsetting"></a>
5218 <h1>AdminSkinvar: getblogsetting</h1>
5219 <p>Blogsettings is output.</p>
5224 <li>url:blog URL</li>
5225 <li>name:blog Name</li>
5226 <li>desc:blog Description</li>
5227 <li>short:blog Short Name</li>
5228 <li>notifyaddress:blog admin notify address</li>
5229 <li>maxcomments:blog Max Comments</li>
5230 <li>updatefile:Update File</li>
5231 <li>timeoffset:Time Offset</li>
5240 <%getblogsetting(url)%>
5246 <a id="adminskinvar-blogsetting" name="adminskinvar-blogsetting"></a>
5247 <h1>AdminSkinvar: blogsetting</h1>
5248 <p>Blogsettings is output.</p>
5253 <li>url:blog URL</li>
5254 <li>name:blog Name</li>
5255 <li>desc:blog Description</li>
5256 <li>short:blog Short Name</li>
5257 <li>notifyaddress:blog admin notify address</li>
5258 <li>maxcomments:blog Max Comments</li>
5259 <li>updatefile:Update File</li>
5260 <li>timeoffset:Time Offset</li>
5274 <%blogsetting(url)%>
5280 <a id="adminskinvar-requestblogid" name="adminskinvar-requestblogid"></a>
5281 <h1>AdminSkinvar: requestblogid</h1>
5282 <p>'blogid' in HTTP Request variables is output.</p>
5290 banlistdeleteconfirm
5303 <%requestblogid%>
5309 <a id="adminskinvar-editadminskintype" name="adminskinvar-editadminskintype"></a>
5310 <h1>AdminSkinvar: editadminskintype</h1>
5311 <p>Information on skin(type) editing at present is output.</p>
5313 <p>name of skin type
5315 <li>id : skin ID</li>
5316 <li>name : skin Name</li>
5317 <li>desc : skin Description</li>
5318 <li>type : skin ContentType</li>
5319 <li>content : skin Content</li>
5320 <li>skintype : skin type friendly name</li>
5321 <li>skintyperaw : skin type</li>
5322 <li>prefix : skin include prefix</li>
5323 <li>mode : skin include mode</li>
5334 <%editadminskintype(name)%>
5340 <a id="adminskinvar-editadminskin" name="adminskinvar-editadminskin"></a>
5341 <h1>AdminSkinvar: editadminskin</h1>
5342 <p>Information on skin editing at present is output.</p>
5344 <p>type of skin setting
5346 <li>id : skin ID</li>
5347 <li>name : skin Name</li>
5348 <li>desc : skin Description</li>
5349 <li>type : skin ContentType</li>
5350 <li>content : skin Content</li>
5351 <li>prefix : skin include prefix</li>
5352 <li>mode : radio button for select skin include mode</li>
5361 <%editadminskin(id)%>
5367 <a id="adminskinvar-defaultadminskintypes" name="adminskinvar-defaultadminskintypes"></a>
5368 <h1>AdminSkinvar: defaultadminskintypes</h1>
5369 <p>A list of the default types of the admin area skin is output.</p>
5371 <p>tabindex, template name</p>
5378 <%defaultadminskintypes(10,admin/default)%>
5384 <a id="adminskinvar-adminspecialskinlist" name="adminskinvar-adminspecialskinlist"></a>
5385 <h1>AdminSkinvar: adminspecialskinlist</h1>
5386 <p>A list of the special types of the admin area skin is output.</p>
5388 <p>template name</p>
5395 <%adminspecialskinlist(admin/default)%>
5401 <a id="adminskinvar-skintypehelp" name="adminskinvar-skintypehelp"></a>
5402 <h1>AdminSkinvar: skintypehelp</h1>
5403 <p>A link to help of the skin type which is being edited at present is output.</p>
5413 <%skintypehelp%>
5419 <a id="adminskinvar-allowedadminskinactions" name="adminskinvar-allowedadminskinactions"></a>
5420 <h1>AdminSkinvar: allowedadminskinactions</h1>
5421 <p>A list with a link to help in practicable skin vars is output by the skin type of admin skin which is being edited at present.</p>
5430 <%allowedadminskinactions%>
5436 <a id="adminskinvar-adminskineditallowedlist" name="adminskinvar-adminskineditallowedlist"></a>
5437 <h1>AdminSkinvar: adminskineditallowedlist</h1>
5438 <p>A list of template or blogs is output as an argument of practicable skin vars by the skin type which is being edited at present.</p>
5440 <p>$type(template/blog),$templateName</p>
5447 <%adminskineditallowedlist(template,admin/default)%>
5453 <a id="adminskinvar-importskininfo" name="adminskinvar-importskininfo"></a>
5454 <h1>AdminSkinvar: importskininfo</h1>
5455 <p>Information on imported skin/template is output.</p>
5460 <li>info : Information on imported skin</li>
5461 <li>snames : Names on imported skin</li>
5462 <li>tnames : Names on imported template</li>
5463 <li>sclashes : Names on imported skin which conflicts</li>
5464 <li>tclashes : Names on imported template which conflicts</li>
5465 <li>skinfile : File names on imported skin</li>
5466 <li>mode : Reading mode of skin</li>
5472 <li>adminskiniedoimport</li>
5473 <li>adminskinieimport</li>
5474 <li>skiniedoimport</li>
5475 <li>skinieimport</li>
5480 <%importskininfo(info)%>
5486 <a id="adminskinvar-selectlocaladminskinfiles" name="adminskinvar-selectlocaladminskinfiles"></a>
5487 <h1>AdminSkinvar: selectlocaladminskinfiles</h1>
5488 <p>The select box from which imported admin skin is chosen is indicated.</p>
5497 <%selectlocaladminskinfiles%>
5503 <a id="adminskinvar-adminskinielist" name="adminskinvar-adminskinielist"></a>
5504 <h1>AdminSkinvar: adminskinielist</h1>
5505 <p>A list of extracted admin skin/template is shown to a file.</p>
5507 <p>type,templateName</p>
5514 <%adminskinielist(template,admin/default)%>
5520 <a id="adminskinvar-adminskinoverview" name="adminskinvar-adminskinoverview"></a>
5521 <h1>AdminSkinvar: adminskinoverview</h1>
5522 <p>A list of admin skins</p>
5531 <%adminskinoverview(admin/default)%>
5537 <a id="adminskinvar-editadmintemplateinfo" name="adminskinvar-editadmintemplateinfo"></a>
5538 <h1>AdminSkinvar: editadmintemplateinfo</h1>
5539 <p>Information on the template which is being edited is indicated.</p>
5545 <li>admintemplatedelete</li>
5546 <li>admintemplateedit</li>
5551 <%editadmintemplateinfo%>
5557 <a id="adminskinvar-admintemplateoverview" name="adminskinvar-admintemplateoverview"></a>
5558 <h1>AdminSkinvar: admintemplateoverview</h1>
5559 <p>A list of template for adminarea.</p>
5564 admntemplateoverview
5568 <%admintemplateoverview(admin/default)%>
5574 <a id="adminskinvar-adminbloglink" name="adminskinvar-adminbloglink"></a>
5575 <h1>AdminSkinvar: adminbloglink</h1>
5576 <p>A link to a blog of id requested in URL is output.</p>
5583 <li>blogcommentlist</li>
5584 <li>blogsettings</li>
5591 <%adminbloglink(admin/default)%>
5597 <a id="adminskinvar-adminbanlist" name="adminskinvar-adminbanlist"></a>
5598 <h1>AdminSkinvar: adminbanlist</h1>
5599 <p>A list of the ip-address which prohibits access to a blog of id requested in url is output.</p>
5608 <%adminbanlist(admin/default)%>
5614 <a id="adminskinvar-requestiprange" name="adminskinvar-requestiprange"></a>
5615 <h1>AdminSkinvar: requestiprange</h1>
5616 <p>ip-range which releases regulation is output.</p>
5625 <%requestiprange%>
5631 <a id="adminskinvar-banlistdeletedlist" name="adminskinvar-banlistdeletedlist"></a>
5632 <h1>AdminSkinvar: banlistdeletedlist</h1>
5633 <p>A list of ip which just released regulation is indicated.</p>
5638 banlistdeleteconfirm
5642 <%banlistdeletedlist(admin/default)%>
5648 <a id="adminskinvar-iprangeinput" name="adminskinvar-iprangeinput"></a>
5649 <h1>AdminSkinvar: iprangeinput</h1>
5650 <p>A list of ip-range regulated now is indicated.</p>
5659 <%iprangeinput%>
5665 <a id="adminskinvar-adminbatchaction" name="adminskinvar-adminbatchaction"></a>
5666 <h1>AdminSkinvar: adminbatchaction</h1>
5667 <p>Requested batchaction is indicated in URL.</p>
5673 <li>batchcategory</li>
5674 <li>batchcomment</li>
5676 <li>batchmember</li>
5682 <%adminbatchaction%>
5688 <a id="adminskinvar-adminbatchlist" name="adminskinvar-adminbatchlist"></a>
5689 <h1>AdminSkinvar: adminbatchlist</h1>
5690 <p>A list of items/comments/members/teams/categories during a batch processing is indicated.</p>
5696 <li>batchcategory</li>
5697 <li>batchcomment</li>
5699 <li>batchmember</li>
5701 <li>blogcommentlist</li>
5707 <%adminbatchlist(admin/default)%>
5713 <a id="adminskinvar-batchdeletetype" name="adminskinvar-batchdeletetype"></a>
5714 <h1>AdminSkinvar: batchdeletetype</h1>
5715 <p>The type of the batched processing method is indicated.</p>
5724 <%batchdeletetype%>
5730 <a id="adminskinvar-batchdeletelist" name="adminskinvar-batchdeletelist"></a>
5731 <h1>AdminSkinvar: batchdeletelist</h1>
5732 <p>The list deleted by batched processing method is indicated.</p>
5741 <%batchdeletelist%>
5747 <a id="adminskinvar-batchmovetitle" name="adminskinvar-batchmovetitle"></a>
5748 <h1>AdminSkinvar: batchmovetitle</h1>
5749 <p>Movement by batched processing method indicates the title which is being processed.</p>
5756 <li>bbatchmovecat</li>
5761 <%batchmovetitle%>
5767 <a id="adminskinvar-batchmovetype" name="adminskinvar-batchmovetype"></a>
5768 <h1>AdminSkinvar: batchmovetype</h1>
5769 <p>The type of the batched processing method of movement is indicated.</p>
5776 <li>batchmovecat</li>
5781 <%batchmovetype%>
5787 <a id="adminskinvar-batchmovelist" name="adminskinvar-batchmovelist"></a>
5788 <h1>AdminSkinvar: batchmovelist</h1>
5789 <p>The list move by batched processing method is indicated.</p>
5796 <li>batchmovecat</li>
5801 <%batchmovelist%>
5807 <a id="adminskinvar-movedistselect" name="adminskinvar-movedistselect"></a>
5808 <h1>AdminSkinvar: movedistselect</h1>
5809 <p>A select box in a movement destination is output.</p>
5816 <li>batchmovecat</li>
5822 <%movedistselect%>
5828 <a id="adminskinvar-batchmovebtn" name="adminskinvar-batchmovebtn"></a>
5829 <h1>AdminSkinvar: batchmovebtn</h1>
5830 <p>A text of Tree peony suitable for the movement type is output.</p>
5837 <li>batchmovecat</li>
5842 <%batchmovebtn%>
5848 <a id="adminskinvar-commentnavlist" name="adminskinvar-commentnavlist"></a>
5849 <h1>AdminSkinvar: commentnavlist</h1>
5850 <p>A list of comments is output.</p>
5856 <li>blogcommentlist</li>
5857 <li>browseowncomments</li>
5858 <li>itemcommentlist/li>
5863 <%commentnavlist%>
5869 <a id="adminskinvar-blogcatlist" name="adminskinvar-blogcatlist"></a>
5870 <h1>AdminSkinvar: blogcatlist</h1>
5871 <p>A list of the categories which are included in the blog which is being edited is output.</p>
5880 <%blogcatlist(admin/default)%>
5886 <a id="adminskinvar-blognotifysetting" name="adminskinvar-blognotifysetting"></a>
5887 <h1>AdminSkinvar: blognotifysetting</h1>
5888 <p>Judgment of whether a check is put in a check box of whether you notify an administrator when there was a comment or vote or new item to a blog, is done.</p>
5890 <p>Type(comment or vote or newitem)</p>
5897 <%blognotifysetting(vote)%>
5903 <a id="adminskinvar-blogsettingyesno" name="adminskinvar-blogsettingyesno"></a>
5904 <h1>AdminSkinvar: blogsettingyesno</h1>
5905 <p>The radio button answered at inside of setting of a blog "Yes." "No." is indicated.</p>
5907 <p>type(convertbreaks or allowpastposting or comments or public or reqemail or searchable),templateName</p>
5914 <%blogsettingyesno(public,admin/default)%>
5920 <a id="adminskinvar-blogteammembers" name="adminskinvar-blogteammembers"></a>
5921 <h1>AdminSkinvar: blogteammembers</h1>
5922 <p>Members list of blog teams is output.</p>
5931 <%blogteammembers%>
5937 <a id="adminskinvar-blogtime" name="adminskinvar-blogtime"></a>
5938 <h1>AdminSkinvar: blogtime</h1>
5939 <p>The time and the time based on offset are output by the form designated in format current as of the server.</p>
5941 <p>type("blogtime" or except),format,offset</p>
5945 <li>blogsettings</li>
5946 <li>createnewlog</li>
5957 <a id="adminskinvar-defcatselect" name="adminskinvar-defcatselect"></a>
5958 <h1>AdminSkinvar: defcatselect</h1>
5959 <p>The select box to which zinc entrusts a category of default is output.</p>
5968 <%defcatselect(admin/default)%>
5974 <a id="adminskinvar-defskinselect" name="adminskinvar-defskinselect"></a>
5975 <h1>AdminSkinvar: defskinselect</h1>
5976 <p>The select box from which skin of a blog or skin of the default applied at the time of blog making newly is chosen is output.</p>
5978 <p>type('blog' or not),templateName</p>
5982 <li>blogsettings</li>
5983 <li>createnewlog</li>
5984 <li>settingsedit</li>
5989 <%defskinselect(blog,admin/default)%>
5995 <a id="adminskinvar-pluginextras" name="adminskinvar-pluginextras"></a>
5996 <h1>AdminSkinvar: pluginextras</h1>
5997 <p>Member/Blog/GeneralSettingsFormExtras or RegistrationFormExtraFields event occur.</p>
6003 <li>blogsettings</li>
6004 <li>createaccountinput</li>
6007 <li>settingsedit</li>
6012 <%pluginextras(blog)%>
6018 <a id="adminskinvar-pluginoptions" name="adminskinvar-pluginoptions"></a>
6019 <h1>AdminSkinvar: pluginoptions</h1>
6020 <p>Setting of a plugin options are output.</p>
6022 <p>context(global or member or blog or category or item),templateName</p>
6026 <li>blogsettings</li>
6027 <li>categoryedit</li>
6029 <li>editmembersettings</li>
6035 <%pluginoptions(blog,admin/default)%>
6041 <a id="adminskinvar-bookmarkletadmin" name="adminskinvar-bookmarkletadmin"></a>
6042 <h1>AdminSkinvar: bookmarkletadmin</h1>
6043 <p>javascript to indicate a bookmark let is output./p>
6052 <%bookmarkletadmin%>
6058 <a id="adminskinvar-itemnavlist" name="adminskinvar-itemnavlist"></a>
6059 <h1>AdminSkinvar: itemnavlist</h1>
6060 <p>A list of contributed items is output.</p>
6070 <%itemnavlist(admin/default)%>
6076 <a id="adminskinvar-categorysetting" name="adminskinvar-categorysetting"></a>
6077 <h1>AdminSkinvar: categorysetting</h1>
6078 <p>Setting of a category is indicated.</p>
6080 <p>Type('name' or not)</p>
6084 <li>categorydelete</li>
6085 <li>categoryedit</li>
6090 <%categorysetting(name)%>
6096 <a id="adminskinvar-editdesturl" name="adminskinvar-editdesturl"></a>
6097 <h1>AdminSkinvar: editdesturl</h1>
6098 <p>URL which indicates a list of the back items to which the category was changed</p>
6107 <%editdesturl%>
6113 <a id="adminskinvar-deletecomment" name="adminskinvar-deletecomment"></a>
6114 <h1>AdminSkinvar: deletecomment</h1>
6115 <p>Information on an eliminated comment is output.</p>
6117 <p>Type(id or author or body)</p>
6124 <%deletecomment(id)%>
6130 <a id="adminskinvar-editcomment" name="adminskinvar-editcomment"></a>
6131 <h1>AdminSkinvar: editcomment</h1>
6132 <p>Information on the comment which is being edited is output.</p>
6134 <p>Type(id or user or date or body or cmail or url or other)</p>
6141 <%editcomment(body)%>
6147 <a id="adminskinvar-contents" name="adminskinvar-contents"></a>
6148 <h1>AdminSkinvar: contents</h1>
6149 <p>Information on the item which is being edited newly and or is output.</p>
6151 <p>which(part for item)</p>
6155 <li>createaccountinput</li>
6156 <li>createaccountsuccess</li>
6163 <%contents(title)%>
6169 <a id="adminskinvar-blogid" name="adminskinvar-blogid"></a>
6170 <h1>AdminSkinvar: blogid</h1>
6171 <p>The ID for the requested blog is output in $_REQUEST.</p>
6186 <a id="adminskinvar-categories" name="adminskinvar-categories"></a>
6187 <h1>AdminSkinvar: categories</h1>
6188 <p>An item outputs the selection box from which the category to which I belong is chosen.</p>
6200 <%categories(40)%>
6206 <a id="adminskinvar-currenttime" name="adminskinvar-currenttime"></a>
6207 <h1>AdminSkinvar: currenttime</h1>
6208 <p>The present time based on the setting of a blog is output.</p>
6213 <td><em>"seconds"</em></td>
6214 <td>Numeric representation of seconds</td>
6217 <td><em>"minutes"</em></td>
6218 <td>Numeric representation of minutes</td>
6221 <td><em>"hours"</em></td>
6222 <td>Numeric representation of hours</td>
6225 <td><em>"mday"</em></td>
6226 <td>Numeric representation of the day of the month</td>
6229 <td><em>"wday"</em></td>
6230 <td>Numeric representation of the day of the week</td>
6233 <td><em>"mon"</em></td>
6234 <td>Numeric representation of a month</td>
6237 <td><em>"year"</em></td>
6238 <td>A full numeric representation of a year, 4 digits</td>
6241 <td><em>"yday"</em></td>
6242 <td>Numeric representation of the day of the year</td>
6245 <td><em>"weekday"</em></td>
6246 <td>A full textual representation of the day of the week</td>
6249 <td><em>"month"</em></td>
6250 <td>A full textual representation of a month, such as January or March</td>
6255 Seconds since the Unix Epoch, similar to the values returned by
6256 <span class="function"><a href="function.time.php" class="function">time()</a></span> and used by <span class="function"><a href="function.date.php" class="function">date()</a></span>.
6270 <%currenttime(month)%>
6276 <a id="adminskinvar-init" name="adminskinvar-init"></a>
6277 <h1>AdminSkinvar: init</h1>
6278 <p>Initialization of contribution or edit processing of an item.</p>
6296 <a id="adminskinvar-adminskinselectoptions" name="adminskinvar-adminskinselectoptions"></a>
6297 <h1>AdminSkinvar: adminskinselectoptions</h1>
6298 <p>The options for selection box from which adminskin is chosen is output.</p>
6307 <%adminskinselectoptions(admin/default)%>
6313 <a id="adminskinvar-editmember" name="adminskinvar-editmember"></a>
6314 <h1>AdminSkinvar: editmember</h1>
6315 <p>The setting form of the editing member is output.</p>
6317 <p>type(id or displayname or realname or email or url or admin or canlogin or notes or autosave),templateName</p>
6321 <li>editmembersettings</li>
6322 <li>memberdelete</li>
6328 <%editmember(url,admin/default)%>
6334 <a id="adminskinvar-localeselectoptions" name="adminskinvar-localeselectoptions"></a>
6335 <h1>AdminSkinvar: localeselectoptions</h1>
6336 <p>The options for select box from which a locale is chosen is output.</p>
6342 <li>editmembersettings</li>
6343 <li>settingsedit</li>
6348 <%localeselectoptions%>
6354 <a id="adminskinvar-deleteitemtitle" name="adminskinvar-deleteitemtitle"></a>
6355 <h1>AdminSkinvar: deleteitemtitle</h1>
6356 <p>The title of the deleted item is indicated.</p>
6365 <%deleteitemtitle%>
6371 <a id="adminskinvar-deleteitembody" name="adminskinvar-deleteitembody"></a>
6372 <h1>AdminSkinvar: deleteitembody</h1>
6373 <p>The body of the deleted item is indicated.</p>
6382 <%deleteitembody%>
6388 <a id="adminskinvar-deleteitemid" name="adminskinvar-deleteitemid"></a>
6389 <h1>AdminSkinvar: deleteitemid</h1>
6390 <p>The ID of the deleted item is indicated.</p>
6399 <%deleteitemid%>
6405 <a id="adminskinvar-checkedonval" name="adminskinvar-checkedonval"></a>
6406 <h1>AdminSkinvar: checkedonval</h1>
6407 <p>Property name of an item lays with value and puts a check in.</p>
6416 <%checkedonval(1,closed)%>
6422 <a id="adminskinvar-itemtime" name="adminskinvar-itemtime"></a>
6423 <h1>AdminSkinvar: itemtime</h1>
6424 <p>The contribution time of the item is output.</p>
6429 <td><em>"seconds"</em></td>
6430 <td>Numeric representation of seconds</td>
6433 <td><em>"minutes"</em></td>
6434 <td>Numeric representation of minutes</td>
6437 <td><em>"hours"</em></td>
6438 <td>Numeric representation of hours</td>
6441 <td><em>"mday"</em></td>
6442 <td>Numeric representation of the day of the month</td>
6445 <td><em>"wday"</em></td>
6446 <td>Numeric representation of the day of the week</td>
6449 <td><em>"mon"</em></td>
6450 <td>Numeric representation of a month</td>
6453 <td><em>"year"</em></td>
6454 <td>A full numeric representation of a year, 4 digits</td>
6457 <td><em>"yday"</em></td>
6458 <td>Numeric representation of the day of the year</td>
6461 <td><em>"weekday"</em></td>
6462 <td>A full textual representation of the day of the week</td>
6465 <td><em>"month"</em></td>
6466 <td>A full textual representation of a month, such as January or March</td>
6471 Seconds since the Unix Epoch, similar to the values returned by
6472 <span class="function"><a href="function.time.php" class="function">time()</a></span> and used by <span class="function"><a href="function.date.php" class="function">date()</a></span>.
6483 <%itemtime(mday)%>
6489 <a id="adminskinvar-ilistaddnew" name="adminskinvar-ilistaddnew"></a>
6490 <h1>AdminSkinvar: ilistaddnew</h1>
6491 <p>A link to a new contribution screen of an item is output.</p>
6500 <%ilistaddnew%>
6506 <a id="adminskinvar-moveitemid" name="adminskinvar-moveitemid"></a>
6507 <h1>AdminSkinvar: moveitemid</h1>
6508 <p>The ID for the item I move is output.</p>
6517 <%moveitemid%>
6523 <a id="adminskinvar-blogteamlist" name="adminskinvar-blogteamlist"></a>
6524 <h1>AdminSkinvar: blogteamlist</h1>
6525 <p>A list of the members who can contribute to a blog is output.</p>
6534 <%blogteamlist(admin/default)%>
6540 <a id="adminskinvar-newmemberselect" name="adminskinvar-newmemberselect"></a>
6541 <h1>AdminSkinvar: newmemberselect</h1>
6542 <p>A select box of the new member who seasons the team which can contribute to a blog is output.</p>
6551 <%newmemberselect(admin/default)%>
6557 <a id="adminskinvar-inputyesno" name="adminskinvar-inputyesno"></a>
6558 <h1>AdminSkinvar: inputyesno</h1>
6559 <p>The form of the question answered at yes or no is output.</p>
6561 <p>name,checkedval(value of the one value1 and value2 check),tabindex,value1,value2,yesval(label for value1),noval(label for value2),isAdmin,templateName</p>
6566 <li>usermanagement</li>
6571 <%inputyesno(canlogin,1,10070)%>
6577 <a id="adminskinvar-yrbloglist" name="adminskinvar-yrbloglist"></a>
6578 <h1>AdminSkinvar: yrbloglist</h1>
6579 <p>A list of the blogs which are being managed is output.</p>
6588 <%yrbloglist(admin/default)%>
6594 <a id="adminskinvar-editpluginfo" name="adminskinvar-editpluginfo"></a>
6595 <h1>AdminSkinvar: editpluginfo</h1>
6596 <p>Information on the plugin which is being edited is output.</p>
6598 <p>Type(id or name)</p>
6602 <li>plugindelete</li>
6603 <li>pluginoptions</li>
6608 <%editpluginfo(name)%>
6614 <a id="adminskinvar-helpplugname" name="adminskinvar-helpplugname"></a>
6615 <h1>AdminSkinvar: helpplugname</h1>
6616 <p>The name of plugin indicating help is output.</p>
6625 <%helpplugname%>
6631 <a id="adminskinvar-pluginhelp" name="adminskinvar-pluginhelp"></a>
6632 <h1>AdminSkinvar: pluginhelp</h1>
6633 <p>help in plugin is output.</p>
6642 <%pluginhelp%>
6648 <a id="adminskinvar-pluginlistlist" name="adminskinvar-pluginlistlist"></a>
6649 <h1>AdminSkinvar: pluginlistlist</h1>
6650 <p>A list of plugin is output.</p>
6659 <%pluginlistlist(admin/default)%>
6665 <a id="adminskinvar-newpluginlist" name="adminskinvar-newpluginlist"></a>
6666 <h1>AdminSkinvar: newpluginlist</h1>
6667 <p>Option tags of a select box of plugins of non-installation are output.</p>
6676 <%newpluginlist%>
6682 <a id="adminskinvar-editplugoptionslist" name="adminskinvar-editplugoptionslist"></a>
6683 <h1>AdminSkinvar: editplugoptionslist</h1>
6684 <p>Plugin options are output.</p>
6693 <%editplugoptionslist(admin/default)%>
6699 <a id="adminskinvar-defblogselect" name="adminskinvar-defblogselect"></a>
6700 <h1>AdminSkinvar: defblogselect</h1>
6701 <p>The select box from which blog in default is chosen is output.</p>
6710 <%defblogselect(admin/default)%>
6716 <a id="adminskinvar-configsettingsedit" name="adminskinvar-configsettingsedit"></a>
6717 <h1>AdminSkinvar: configsettingsedit</h1>
6718 <p>The form about the setting of a site is output.</p>
6720 <p>Type(DefaultListSize or SessionCookie or URLMode)</p>
6727 <%configsettingsedit(URLMode)%>
6733 <a id="adminskinvar-configsettingsyesno" name="adminskinvar-configsettingsyesno"></a>
6734 <h1>AdminSkinvar: configsettingsyesno</h1>
6735 <p>The form answered at yes or no about the setting of a site is output.</p>
6737 <p>Type($CONF keys),tabindex</p>
6744 <%configsettingsyesno(DisableSite, 10060)%>
6750 <a id="adminskinvar-outputspecialdirs" name="adminskinvar-outputspecialdirs"></a>
6751 <h1>AdminSkinvar: outputspecialdirs</h1>
6752 <p>A path of a special directory is output.</p>
6754 <p>Type(nucleusdir or mediadir)</p>
6761 <%outputspecialdirs(mediadir)%>
6767 <a id="adminskinvar-jstoolbaroptions" name="adminskinvar-jstoolbaroptions"></a>
6768 <h1>AdminSkinvar: jstoolbaroptions</h1>
6769 <p>The select box from which the type of the tool bar of javascript is chosen is output.</p>
6778 <%jstoolbaroptions%>
6784 <a id="adminskinvar-mediadirwarning" name="adminskinvar-mediadirwarning"></a>
6785 <h1>AdminSkinvar: mediadirwarning</h1>
6786 <p>Warning of a media directory is output.</p>
6795 <%mediadirwarning%>
6801 <a id="adminskinvar-passrequestvars" name="adminskinvar-passrequestvars"></a>
6802 <h1>AdminSkinvar: passrequestvars</h1>
6812 <%passrequestvars%>
6818 <a id="adminskinvar-editskintype" name="adminskinvar-editskintype"></a>
6819 <h1>AdminSkinvar: editskintype</h1>
6820 <p>Information on the skintype which is being edited is output.</p>
6822 <p>Type(id or name or desc or type or content or skintype or skintyperaw or prefix or mode)</p>
6827 <li>skinedittype</li>
6828 <li>skinremovetype</li>
6833 <%editskintype(mode)%>
6839 <a id="adminskinvar-editskin" name="adminskinvar-editskin"></a>
6840 <h1>AdminSkinvar: editskin</h1>
6841 <p>Information on the skin which is being edited is output.</p>
6843 <p>Type(id or name or desc or type or prefix or mode)</p>
6850 <%editskin(desc)%>
6856 <a id="adminskinvar-specialskinlist" name="adminskinvar-specialskinlist"></a>
6857 <h1>AdminSkinvar: specialskinlist</h1>
6858 <p>A list of special skins is output.</p>
6867 <%specialskinlist(admin/default)%>
6873 <a id="adminskinvar-allowedskinactions" name="adminskinvar-allowedskinactions"></a>
6874 <h1>AdminSkinvar: allowedskinactions</h1>
6875 <p>A list with a link to help in practicable skin vars is output by the skin type of skin which is being edited at present.</p>
6884 <%allowedskinactions%>
6890 <a id="adminskinvar-skineditallowedlist" name="adminskinvar-skineditallowedlist"></a>
6891 <h1>AdminSkinvar: skineditallowedlist</h1>
6892 <p>A list of template or blogs is output as an argument of practicable skin vars by the skin type which is being edited at present.</p>
6894 <p>type(blog or temolate),templateName</p>
6901 <%skineditallowedlist(template,admin/default)%>
6907 <a id="adminskinvar-selectlocalskinfiles" name="adminskinvar-selectlocalskinfiles"></a>
6908 <h1>AdminSkinvar: selectlocalskinfiles</h1>
6909 <p>The select box from which imported skin is chosen is indicated.</p>
6918 <%selectlocalskinfiles%>
6924 <a id="adminskinvar-skinielist" name="adminskinvar-skinielist"></a>
6925 <h1>AdminSkinvar: skinielist</h1>
6926 <p>A list of extracted skin/template is shown to a file.</p>
6928 <p>type,templateName</p>
6935 <%skinielist(template,admin/default)%>
6941 <a id="adminskinvar-skinoverview" name="adminskinvar-skinoverview"></a>
6942 <h1>AdminSkinvar: skinoverview</h1>
6943 <p>A list of skins.</p>
6952 <%skinoverview(admin/default)%>
6958 <a id="adminskinvar-edittemplateinfo" name="adminskinvar-edittemplateinfo"></a>
6959 <h1>AdminSkinvar: edittemplateinfo</h1>
6960 <p>Information on the template which is being edited is output.</p>
6962 <p>type[,desc[,name[,help[,tabindex[,big[,tplt]]]]]]</p>
6966 <li>templatedelete</li>
6967 <li>templateedit</li>
6972 <%edittemplateinfo(name)%>
6978 <a id="adminskinvar-templateoverview" name="adminskinvar-templateoverview"></a>
6979 <h1>AdminSkinvar: templateoverview</h1>
6980 <p>A list of templates.</p>
6989 <%templateoverview(admin/default)%>
6995 <a id="adminskinvar-editmemberlist" name="adminskinvar-editmemberlist"></a>
6996 <h1>AdminSkinvar: editmemberlist</h1>
6997 <p>The members list which is being edited.</p>
7006 <%editmemberlist(admin/default)%>
7011 <a id="skinpartactionlog" name="skinpartactionlog"></a>
7012 <h1>Admin skins: Action Log</h1>
7014 This skinpart is used to show Action Log.
7017 Very basic buildup for actionlog page:
7021 <p><a href="<%adminurl%>index.php?action=manage">(<%text(_BACKTOMANAGE)%>)</a></p>
7022 <h2><%text(_ACTIONLOG_CLEAR_TITLE)%></h2>
7023 <p><a href="<%adminurl%><%addtickettourl(index.php?action=clearactionlog)%>"><%text(_ACTIONLOG_CLEAR_TEXT)%></a></p>
7024 <h2><%text(_ACTIONLOG_TITLE)%></h2>
7025 <%actionloglist(admin/default)%>
7032 <a id="skinpartactivate" name="skinpartactivate"></a>
7033 <h1>Admin skins: Account Activation</h1>
7035 This skinpart is used to show Account Activation.
7038 Very basic buildup for a activate page:
7041 <%pagehead%><h2><%activationmessage(title)%></h2>
7042 <p><%activationmessage(text)%></p>
7043 <p class="error"><%headmessage%></p>
7044 <%if(bechangepass)%><div>
7045 <form action="<%adminurl%>index.php" method="post">
7046 <input type="hidden" name="action" value="activatesetpwd" />
7048 <input type="hidden" name="key" value="<%activationmessage(ackey)%>" />
7051 <td><%text(_MEMBERS_PWD)%></td>
7052 <td><input type="password" maxlength="40" size="16" name="password" /></td>
7053 </tr><tr>
7054 <td><%text(_MEMBERS_REPPWD)%></td>
7055 <td><input type="password" maxlength="40" size="16" name="repeatpassword" /></td>
7056 <%eventformextra(activation)%>
7057 </tr><tr>
7058 <td><%text(_MEMBERS_SETPWD)%></td>
7059 <td><input type="submit" value="<%text(_MEMBERS_SETPWD_BTN)%>" /></td>
7063 </div><%endif%><%pagefoot%>
7069 <a id="skinpartactivatesetpwd" name="skinpartactivatesetpwd"></a>
7070 <h1>Admin skins: activatesetpwd</h1>
7072 This skinpart is used to show Set Password.
7075 Very basic buildup for a activatesetpwd page:
7078 <%pagehead%><h2><%text(_ACTIVATE_SUCCESS_TITLE)%></h2>
7079 <p><%text(_ACTIVATE_SUCCESS_TEXT)%></p><%pagefoot%>
7085 <a id="skinpartaddnewlog" name="skinpartaddnewlog"></a>
7086 <h1>Admin skins: addnewlog</h1>
7088 This skinpart is used to New weblog created.
7091 Very basic buildup for a addnewlog page:
7094 <%pagehead%><h2><%text(_BLOGCREATED_TITLE)%></h2>
7095 <p><%sprinttext(_BLOGCREATED_ADDEDTXT,<|%createdblogsetting(name)%|>)%></p>
7097 <li><a href="#index_php"><%sprinttext(_BLOGCREATED_SIMPLEWAY,<|%getblogsetting(short)%|>)%></a></li>
7098 <li><a href="#skins"><%text(_BLOGCREATED_ADVANCEDWAY)%></a></li>
7100 <h3><a id="index_php"><%sprinttext(_BLOGCREATED_SIMPLEDESC1,<|%getblogsetting(short)%|>)%></a></h3>
7101 <p><%sprinttext(_BLOGCREATED_SIMPLEDESC2,<|%getblogsetting(short)%|>)%></p>
7102 <pre><code>&lt;?php
7104 $CONF['Self'] = '<b><%blogsetting(short)%>.php</b>';
7106 include('<i>./config.php</i>');
7108 selectBlog('<b><%blogsetting(short)%></b>');
7111 ?&gt;</code></pre>
7112 <p><%text(_BLOGCREATED_SIMPLEDESC3)%></p>
7113 <p><%text(_BLOGCREATED_SIMPLEDESC4)%></p>
7114 <form action="<%adminurl%>index.php" method="post">
7116 <input type="hidden" name="action" value="addnewlog2" />
7118 <input type="hidden" name="blogid" value="<%requestblogid%>" />
7121 <td><%text(_EBLOG_URL)%></td>
7122 <td><input name="url" maxlength="100" size="40" value="<%sitevar(url)%><%blogsetting(short)%>.php" /></td>
7123 </tr><tr>
7124 <td><%text(_EBLOG_CREATE)%></td>
7125 <td><input type="submit" value="<%text(_EBLOG_CREATE_BTN)%>" onclick="return checkSubmit();" /></td>
7130 <h3><a id="skins"><%text(_BLOGCREATED_ADVANCEDWAY2)%></a></h3>
7131 <p><%text(_BLOGCREATED_ADVANCEDWAY3)%></p>
7132 <form action="<%adminurl%>index.php" method="post">
7134 <input type="hidden" name="action" value="addnewlog2" />
7136 <input type="hidden" name="blogid" value="<%requestblogid%>" />
7139 <td><%text(_EBLOG_URL)%></td>
7140 <td><input name="url" maxlength="100" size="40" /></td>
7141 </tr><tr>
7142 <td><%text(_EBLOG_CREATE)%></td>
7143 <td><input type="submit" value="<%text(_EBLOG_CREATE_BTN)%>" onclick="return checkSubmit();" /></td>
7147 </form><%pagefoot%>
7153 <a id="skinpartadminerrorpage" name="skinpartadminerrorpage"></a>
7154 <h1>Admin skins: adminerrorpage</h1>
7156 This skinpart is used to Nucleus management...Error.
7159 Very basic buildup for adminerrorpage page:
7162 <%pagehead%> <h2>Error!</h2>
7163 <%headmessage%>
7165 <a href="<%adminurl%>index.php" onclick="history.back()"><%text(_BACK)%></a>
7172 <a id="skinpartadminskindelete" name="skinpartadminskindelete"></a>
7173 <h1>Admin skins: dminskindelete</h1>
7175 This skinpart is used to Admin layout You’re about to delete the skin named .
7178 Very basic buildup for dminskindelete page:
7182 <h2><%text(_DELETE_CONFIRM)%></h2>
7183 <p><%text(_CONFIRMTXT_SKIN)%><b><%editadminskintype(name)%></b> (<%editadminskintype(desc)%>)</p>
7184 <form method="post" action="<%adminurl%>index.php">
7186 <input type="hidden" name="action" value="adminskindeleteconfirm" />
7188 <input type="hidden" name="skinid" value="<%editadminskintype(id)%>" />
7189 <input type="submit" tabindex="10" value="<%text(_DELETE_CONFIRM_BTN)%>" />
7198 <a id="skinpartadminskinedit" name="skinpartadminskinedit"></a>
7199 <h1>Admin skins: adminskinedit</h1>
7201 This skinpart is used to Admin layout Edit skin.
7204 Very basic buildup for a adminskinedit page:
7207 <%pagehead%><p><a href="<%adminurl%>index.php?action=adminskinoverview">(<%text(_SKIN_BACK)%>)</a></p>
7208 <h2><%text(_SKIN_EDITONE_TITLE)%> '<%editadminskin(name)%>'</h2>
7209 <h3><%text(_SKIN_PARTS_TITLE)%></h3>
7210 <%text(_SKIN_PARTS_MSG)%>
7211 <%defaultadminskintypes(10,admin/default)%>
7212 <h3><%text(_SKIN_PARTS_SPECIAL)%></h3>
7213 <form method="get" action="<%adminurl%>index.php">
7214 <input type="hidden" name="action" value="adminskinedittype" />
7215 <input type="hidden" name="skinid" value="<%editadminskin(id)%>" />
7216 <input name="type" tabindex="89" size="30" maxlength="64" />
7217 <input type="submit" tabindex="140" value="<%text(_SKIN_CREATE)%>" onclick="return checkSubmit();" />
7219 <%adminspecialskinlist(admin/default)%>
7220 <h3><%text(_SKIN_GENSETTINGS_TITLE)%></h3>
7221 <form method="post" action="<%adminurl%>index.php">
7223 <input type="hidden" name="action" value="adminskineditgeneral" />
7225 <input type="hidden" name="skinid" value="<%editadminskin(id)%>" />
7228 <td><%text(_SKIN_NAME)%> <%helplink(shortnames)%></td>
7229 <td><input name="name" tabindex="90" value="<%editadminskin(name)%>" maxlength="64" size="30" /></td>
7230 </tr><tr>
7231 <td><%text(_SKIN_DESC)%></td>
7232 <td><input name="desc" tabindex="100" value="<%editadminskin(desc)%>" maxlength="200" size="50" /></td>
7233 </tr><tr>
7234 <td><%text(_SKIN_TYPE)%></td>
7235 <td><input name="type" tabindex="110" value="<%editadminskin(type)%>" maxlength="40" size="20" /></td>
7236 </tr><tr>
7237 <td><%text(_SKIN_INCLUDE_MODE)%> <%helplink(includemode)%></td>
7238 <td><%editadminskin(mode)%></td>
7239 </tr><tr>
7240 <td><%text(_SKIN_INCLUDE_PREFIX)%> <%helplink(includeprefix)%></td>
7241 <td><input name="inc_prefix" tabindex="130" value="<%editadminskin(prefix)%>" maxlength="40" size="20" /></td>
7242 </tr><tr>
7243 <td><%text(_SKIN_CHANGE)%></td>
7244 <td><input type="submit" tabindex="140" value="<%text(_SKIN_CHANGE_BTN)%>" onclick="return checkSubmit();" /></td>
7245 </tr></table>
7247 </form><%pagefoot%>
7253 <a name="skinpartadminskinedittype"></a>
7254 <h1>Admin skins: adminskinedittype</h1>
7256 This skinpart is used to Admin layout Edit skin.
7259 Very basic buildup for a adminskinedittype page:
7262 <%pagehead%><p>(<a href="<%adminurl%>index.php?action=adminskinoverview"><%text(_SKIN_GOBACK)%></a>)</p>
7263 <h2><%text(_SKIN_EDITPART_TITLE)%> '<%editadminskintype(name)%>': <%editadminskintype(skintype)%></h2>
7264 <%headmessage%>
7265 <form method="post" action="<%adminurl%>index.php">
7267 <input type="hidden" name="action" value="adminskinupdate" />
7269 <input type="hidden" name="skinid" value="<%editadminskintype(id)%>" />
7270 <input type="hidden" name="type" value="<%editadminskintype(skintyperaw)%>" />
7271 <input type="submit" value="<%text(_SKIN_UPDATE_BTN)%>" onclick="return checkSubmit();" />
7272 <input type="reset" value="<%text(_SKIN_RESET_BTN)%>" />
7273 (skin type: <%editadminskintype(skintype)%>)<%skintypehelp%><br />
7274 <textarea class="skinedit" tabindex="10" rows="20" cols="80" name="content"><%editadminskintype(content)%></textarea><br />
7275 <input type="submit" tabindex="20" value="<%text(_SKIN_UPDATE_BTN)%>" onclick="return checkSubmit();" />
7276 <input type="reset" value="<%text(_SKIN_RESET_BTN)%>" />
7277 (skin type: <%editadminskintype(skintype)%>)
7278 <br /><br />
7279 <%text(_SKIN_ALLOWEDVARS)%>
7280 <%allowedadminskinactions%><br /><br />
7281 <%text(_SKINEDIT_ALLOWEDTEMPLATESS)%>
7282 <%adminskineditallowedlist(template)%><br />
7284 </form><%pagefoot%>
7290 <a name="skinpartadminskiniedoimport"></a>
7291 <h1>Admin skins: adminskiniedoimport</h1>
7293 This skinpart is used to Admin layout Done Importing.
7296 Very basic buildup for a adminskiniedoimport page:
7299 <%pagehead%><p><a href="<%adminurl%>index.php?action=manage">(<%text(_BACKTOMANAGE)%>)</a></p>
7300 <h2><%text(_SKINIE_DONE)%></h2>
7303 <li><p><strong><%text(_SKINIE_INFO_GENERAL)%></strong> <%importskininfo(info)%></p></li>
7304 <li><p><strong><%text(_SKINIE_INFO_IMPORTEDSKINS)%></strong> <%importskininfo(snames)%></p></li>
7305 <li><p><strong><%text(_SKINIE_INFO_IMPORTEDTEMPLS)%></strong> <%importskininfo(tnames)%></p></li>
7306 </ul><%pagefoot%>
7312 <a name="skinpartadminskinieimport"></a>
7313 <h1>Admin skins: adminskinieimport</h1>
7315 This skinpart is used to Admin layout About to import skins and templates.
7318 Very basic buildup for a adminskinieimport page:
7321 <%pagehead%><p><a href="<%adminurl%>index.php?action=adminskinieoverview">(<%text(_BACK)%>)</a></p>
7322 <h2><%text(_SKINIE_CONFIRM_TITLE)%></h2>
7325 <li><p><strong><%text(_SKINIE_INFO_GENERAL)%></strong> <%importskininfo(info)%></p></li>
7326 <li><p><strong><%text(_SKINIE_INFO_SKINS)%></strong> <%importskininfo(snames)%></p></li>
7327 <li><p><strong><%text(_SKINIE_INFO_TEMPLATES)%></strong> <%importskininfo(tnames)%></p></li>
7328 <%if(nameclashes)%><li><p><strong style="color: red;"><%text(_SKINIE_INFO_SKINCLASH)%></strong> <%importskininfo(sclashes)%></p></li>
7329 <li><p><strong style="color: red;"><%text(_SKINIE_INFO_TEMPLCLASH)%></strong> <%importskininfo(tclashes)%></p></li><%endif%>
7332 <form method="post" action="<%adminurl%>index.php"><div>
7333 <input type="hidden" name="action" value="adminskiniedoimport" />
7335 <input type="hidden" name="skinfile" value="<%importskininfo(skinfile)%>" />
7336 <input type="hidden" name="mode" value="<%importskininfo(mode)%>" />
7337 <input type="submit" value="<%text(_SKINIE_CONFIRM_IMPORT)%>" />
7338 <%if(nameclashes)%><br />
7339 <input type="checkbox" name="overwrite" value="1" id="cb_overwrite" /><label for="cb_overwrite"><%text(_SKINIE_CONFIRM_OVERWRITE)%></label><%endif%>
7340 </div></form><%pagefoot%>
7346 <a name="skinpartadminskinieoverview"></a>
7347 <h1>Admin skins: adminskinieoverview</h1>
7349 This skinpart is used to Admin layout Import/Export.
7352 Very basic buildup for a adminskinieoverview page:
7355 <%pagehead%><p><a href="<%adminurl%>index.php?action=manage">(<%text(_BACKTOMANAGE)%>)</a></p>
7356 <h2><%text(_SKINIE_TITLE_IMPORT)%></h2>
7358 <label for="skinie_import_local"><%text(_SKINIE_LOCAL)%></label>
7359 <%if(superadmin)%><form method="post" action="<%adminurl%>index.php">
7361 <input type="hidden" name="action" value="adminskinieimport" />
7363 <input type="hidden" name="mode" value="file" />
7364 <select name="skinfile" id="skinie_import_local">
7365 <%selectlocaladminskinfiles%>
7367 <input type="submit" value="<%text(_SKINIE_BTN_IMPORT)%>" />
7369 </form><%else%><%text(_SKINIE_NOCANDIDATES)%><%endif%>
7371 <p><em><%text(_OR)%></em></p>
7372 <form method="post" action="<%adminurl%>index.php">
7375 <input type="hidden" name="action" value="adminskinieimport" />
7376 <input type="hidden" name="mode" value="url" />
7377 <label for="skinie_import_url"><%text(_SKINIE_FROMURL)%></label>
7378 <input type="text" name="skinfile" id="skinie_import_url" size="60" value="http://" />
7379 <input type="submit" value="<%text(_SKINIE_BTN_IMPORT)%>" />
7382 <h2><%text(_SKINIE_TITLE_EXPORT)%></h2>
7383 <form method="post" action="<%adminurl%>index.php">
7385 <input type="hidden" name="action" value="adminskinieexport" />
7387 <p><%text(_SKINIE_EXPORT_INTRO)%></p>
7390 <th colspan="2"><%text(_SKINIE_EXPORT_SKINS)%></th>
7391 </tr><tr>
7392 <%adminskinielist(skin,admin/default)%>
7393 <th colspan="2"><%text(_SKINIE_EXPORT_TEMPLATES)%></th>
7394 </tr><tr>
7395 <%adminskinielist(template,admin/default)%>
7396 <th colspan="2"><%text(_SKINIE_EXPORT_EXTRA)%></th>
7397 </tr><tr>
7398 <td colspan="2"><textarea cols="40" rows="5" name="info"></textarea></td>
7399 </tr><tr>
7400 <th colspan="2"><%text(_SKINIE_TITLE_EXPORT)%></th>
7401 </tr><tr>
7402 <td colspan="2"><input type="submit" value="<%text(_SKINIE_BTN_EXPORT)%>" /></td>
7406 </form><%pagefoot%>
7412 <a name="skinpartadminskinoverview"></a>
7413 <h1>Admin skins: skinpart</h1>
7415 This skinpart is used to expt.
7418 Very basic buildup for a main index:
7431 <a name="skinpartadminskinremovetype"></a>
7432 <h1>Admin skins: skinpart</h1>
7434 This skinpart is used to expt.
7437 Very basic buildup for a main index:
7450 <a name="skinpartadmintemplatedelete"></a>
7451 <h1>Admin skins: skinpart</h1>
7453 This skinpart is used to expt.
7456 Very basic buildup for a main index:
7469 <a name="skinpartadmintemplateedit"></a>
7470 <h1>Admin skins: skinpart</h1>
7472 This skinpart is used to expt.
7475 Very basic buildup for a main index:
7488 <a name="skinpartadmntemplateoverview"></a>
7489 <h1>Admin skins: skinpart</h1>
7491 This skinpart is used to expt.
7494 Very basic buildup for a main index:
7507 <a name="skinpartbackupoverview"></a>
7508 <h1>Admin skins: skinpart</h1>
7510 This skinpart is used to expt.
7513 Very basic buildup for a main index:
7526 <a name="skinpartbackuprestore"></a>
7527 <h1>Admin skins: skinpart</h1>
7529 This skinpart is used to expt.
7532 Very basic buildup for a main index:
7545 <a name="skinpartbanlist"></a>
7546 <h1>Admin skins: skinpart</h1>
7548 This skinpart is used to expt.
7551 Very basic buildup for a main index:
7564 <a name="skinpartbanlistdelete"></a>
7565 <h1>Admin skins: skinpart</h1>
7567 This skinpart is used to expt.
7570 Very basic buildup for a main index:
7583 <a name="skinpartbanlistdeleteconfirm"></a>
7584 <h1>Admin skins: skinpart</h1>
7586 This skinpart is used to expt.
7589 Very basic buildup for a main index:
7602 <a name="skinpartbanlistnew"></a>
7603 <h1>Admin skins: skinpart</h1>
7605 This skinpart is used to expt.
7608 Very basic buildup for a main index:
7621 <a name="skinpartbatchcategory"></a>
7622 <h1>Admin skins: skinpart</h1>
7624 This skinpart is used to expt.
7627 Very basic buildup for a main index:
7640 <a name="skinpartbatchcomment"></a>
7641 <h1>Admin skins: skinpart</h1>
7643 This skinpart is used to expt.
7646 Very basic buildup for a main index:
7659 <a name="skinpartbatchdelete"></a>
7660 <h1>Admin skins: skinpart</h1>
7662 This skinpart is used to expt.
7665 Very basic buildup for a main index:
7678 <a name="skinpartbatchitem"></a>
7679 <h1>Admin skins: skinpart</h1>
7681 This skinpart is used to expt.
7684 Very basic buildup for a main index:
7697 <a name="skinpartbatchmember"></a>
7698 <h1>Admin skins: skinpart</h1>
7700 This skinpart is used to expt.
7703 Very basic buildup for a main index:
7716 <a name="skinpartbatchmove"></a>
7717 <h1>Admin skins: skinpart</h1>
7719 This skinpart is used to expt.
7722 Very basic buildup for a main index:
7735 <a name="skinpartbatchmovecat"></a>
7736 <h1>Admin skins: skinpart</h1>
7738 This skinpart is used to expt.
7741 Very basic buildup for a main index:
7754 <a name="skinpartbatchteam"></a>
7755 <h1>Admin skins: skinpart</h1>
7757 This skinpart is used to expt.
7760 Very basic buildup for a main index:
7773 <a name="skinpartblogcommentlist"></a>
7774 <h1>Admin skins: skinpart</h1>
7776 This skinpart is used to expt.
7779 Very basic buildup for a main index:
7792 <a name="skinpartblogsettings"></a>
7793 <h1>Admin skins: skinpart</h1>
7795 This skinpart is used to expt.
7798 Very basic buildup for a main index:
7811 <a name="skinpartbookmarklet"></a>
7812 <h1>Admin skins: skinpart</h1>
7814 This skinpart is used to expt.
7817 Very basic buildup for a main index:
7830 <a name="skinpartbrowseowncomments"></a>
7831 <h1>Admin skins: skinpart</h1>
7833 This skinpart is used to expt.
7836 Very basic buildup for a main index:
7849 <a name="skinpartbrowseownitems"></a>
7850 <h1>Admin skins: skinpart</h1>
7852 This skinpart is used to expt.
7855 Very basic buildup for a main index:
7868 <a name="skinpartcategorydelete"></a>
7869 <h1>Admin skins: skinpart</h1>
7871 This skinpart is used to expt.
7874 Very basic buildup for a main index:
7887 <a name="skinpartcategoryedit"></a>
7888 <h1>Admin skins: skinpart</h1>
7890 This skinpart is used to expt.
7893 Very basic buildup for a main index:
7906 <a name="skinpartcommentdelete"></a>
7907 <h1>Admin skins: skinpart</h1>
7909 This skinpart is used to expt.
7912 Very basic buildup for a main index:
7925 <a name="skinpartcommentedit"></a>
7926 <h1>Admin skins: skinpart</h1>
7928 This skinpart is used to expt.
7931 Very basic buildup for a main index:
7944 <a name="skinpartcreateitem"></a>
7945 <h1>Admin skins: skinpart</h1>
7947 This skinpart is used to expt.
7950 Very basic buildup for a main index:
7963 <a name="skinpartcreatenewlog"></a>
7964 <h1>Admin skins: skinpart</h1>
7966 This skinpart is used to expt.
7969 Very basic buildup for a main index:
7982 <a name="skinpartcreateaccountinput"></a>
7983 <h1>Admin skins: skinpart</h1>
7985 This skinpart is used to expt.
7988 Very basic buildup for a main index:
8001 <a name="skinpartcreateaccountsuccess"></a>
8002 <h1>Admin skins: skinpart</h1>
8004 This skinpart is used to expt.
8007 Very basic buildup for a main index:
8020 <a name="skinpartcreateaccountdisable"></a>
8021 <h1>Admin skins: skinpart</h1>
8023 This skinpart is used to expt.
8026 Very basic buildup for a main index:
8039 <a name="skinpartdeleteblog"></a>
8040 <h1>Admin skins: skinpart</h1>
8042 This skinpart is used to expt.
8045 Very basic buildup for a main index:
8058 <a name="skinparteditmembersettings"></a>
8059 <h1>Admin skins: skinpart</h1>
8061 This skinpart is used to expt.
8064 Very basic buildup for a main index:
8077 <a name="skinpartforgotpassword"></a>
8078 <h1>Admin skins: skinpart</h1>
8080 This skinpart is used to expt.
8083 Very basic buildup for a main index:
8096 <a name="skinpartitemcommentlist"></a>
8097 <h1>Admin skins: skinpart</h1>
8099 This skinpart is used to expt.
8102 Very basic buildup for a main index:
8115 <a name="skinpartitemdelete"></a>
8116 <h1>Admin skins: skinpart</h1>
8118 This skinpart is used to expt.
8121 Very basic buildup for a main index:
8134 <a name="skinpartitemedit"></a>
8135 <h1>Admin skins: skinpart</h1>
8137 This skinpart is used to expt.
8140 Very basic buildup for a main index:
8153 <a name="skinpartitemlist"></a>
8154 <h1>Admin skins: skinpart</h1>
8156 This skinpart is used to expt.
8159 Very basic buildup for a main index:
8172 <a name="skinpartitemmove"></a>
8173 <h1>Admin skins: skinpart</h1>
8175 This skinpart is used to expt.
8178 Very basic buildup for a main index:
8191 <a name="skinpartmanage"></a>
8192 <h1>Admin skins: skinpart</h1>
8194 This skinpart is used to expt.
8197 Very basic buildup for a main index:
8210 <a name="skinpartmanageteam"></a>
8211 <h1>Admin skins: skinpart</h1>
8213 This skinpart is used to expt.
8216 Very basic buildup for a main index:
8229 <a name="skinpartmemberdelete"></a>
8230 <h1>Admin skins: skinpart</h1>
8232 This skinpart is used to expt.
8235 Very basic buildup for a main index:
8248 <a name="skinpartoverview"></a>
8249 <h1>Admin skins: skinpart</h1>
8251 This skinpart is used to expt.
8254 Very basic buildup for a main index:
8267 <a name="skinpartpagefoot"></a>
8268 <h1>Admin skins: skinpart</h1>
8270 This skinpart is used to expt.
8273 Very basic buildup for a main index:
8286 <a name="skinpartpagehead"></a>
8287 <h1>Admin skins: skinpart</h1>
8289 This skinpart is used to expt.
8292 Very basic buildup for a main index:
8305 <a name="skinpartplugindelete"></a>
8306 <h1>Admin skins: skinpart</h1>
8308 This skinpart is used to expt.
8311 Very basic buildup for a main index:
8324 <a name="skinpartpluginhelp"></a>
8325 <h1>Admin skins: skinpart</h1>
8327 This skinpart is used to expt.
8330 Very basic buildup for a main index:
8343 <a name="skinpartpluginlist"></a>
8344 <h1>Admin skins: skinpart</h1>
8346 This skinpart is used to expt.
8349 Very basic buildup for a main index:
8362 <a name="skinpartpluginoptions"></a>
8363 <h1>Admin skins: skinpart</h1>
8365 This skinpart is used to expt.
8368 Very basic buildup for a main index:
8381 <a name="skinpartsettingsedit"></a>
8382 <h1>Admin skins: skinpart</h1>
8384 This skinpart is used to expt.
8387 Very basic buildup for a main index:
8400 <a name="skinpartshowlogin"></a>
8401 <h1>Admin skins: skinpart</h1>
8403 This skinpart is used to expt.
8406 Very basic buildup for a main index:
8419 <a name="skinpartskindelete"></a>
8420 <h1>Admin skins: skinpart</h1>
8422 This skinpart is used to expt.
8425 Very basic buildup for a main index:
8438 <a name="skinpartskinedit"></a>
8439 <h1>Admin skins: skinpart</h1>
8441 This skinpart is used to expt.
8444 Very basic buildup for a main index:
8457 <a name="skinpartskinedittype"></a>
8458 <h1>Admin skins: skinpart</h1>
8460 This skinpart is used to expt.
8463 Very basic buildup for a main index:
8476 <a name="skinpartskiniedoimport"></a>
8477 <h1>Admin skins: skinpart</h1>
8479 This skinpart is used to expt.
8482 Very basic buildup for a main index:
8495 <a name="skinpartskinieimport"></a>
8496 <h1>Admin skins: skinpart</h1>
8498 This skinpart is used to expt.
8501 Very basic buildup for a main index:
8514 <a name="skinpartskinieoverview"></a>
8515 <h1>Admin skins: skinpart</h1>
8517 This skinpart is used to expt.
8520 Very basic buildup for a main index:
8533 <a name="skinpartskinoverview"></a>
8534 <h1>Admin skins: skinpart</h1>
8536 This skinpart is used to expt.
8539 Very basic buildup for a main index:
8552 <a name="skinpartskinremovetype"></a>
8553 <h1>Admin skins: skinpart</h1>
8555 This skinpart is used to expt.
8558 Very basic buildup for a main index:
8571 <a name="skinpartsystemoverview"></a>
8572 <h1>Admin skins: skinpart</h1>
8574 This skinpart is used to expt.
8577 Very basic buildup for a main index:
8590 <a name="skinpartteamdelete"></a>
8591 <h1>Admin skins: skinpart</h1>
8593 This skinpart is used to expt.
8596 Very basic buildup for a main index:
8609 <a name="skinparttemplatedelete"></a>
8610 <h1>Admin skins: skinpart</h1>
8612 This skinpart is used to expt.
8615 Very basic buildup for a main index:
8628 <a name="skinparttemplateedit"></a>
8629 <h1>Admin skins: skinpart</h1>
8631 This skinpart is used to expt.
8634 Very basic buildup for a main index:
8647 <a name="skinparttemplateoverview"></a>
8648 <h1>Admin skins: skinpart</h1>
8650 This skinpart is used to expt.
8653 Very basic buildup for a main index:
8666 <a name="skinpartusermanagement"></a>
8667 <h1>Admin skins: skinpart</h1>
8669 This skinpart is used to expt.
8672 Very basic buildup for a main index: